Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 1677024..1678161 | Replicon | chromosome |
Accession | NZ_CP124898 | ||
Organism | Enterococcus faecalis strain EfsC109-2 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | QLQ52_RS08035 | Protein ID | WP_002401483.1 |
Coordinates | 1677024..1677887 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | QLQ52_RS08040 | Protein ID | WP_000301765.1 |
Coordinates | 1677889..1678161 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ52_RS08005 (1672822) | 1672822..1673589 | - | 768 | WP_002357481.1 | ribonuclease HII | - |
QLQ52_RS08010 (1673591) | 1673591..1674442 | - | 852 | WP_002357480.1 | ribosome biogenesis GTPase YlqF | - |
QLQ52_RS08015 (1674718) | 1674718..1675149 | - | 432 | Protein_1577 | ketopantoate reductase C-terminal domain-containing protein | - |
QLQ52_RS08020 (1675205) | 1675205..1675885 | - | 681 | WP_010710189.1 | IS6-like element IS1216 family transposase | - |
QLQ52_RS08025 (1675959) | 1675959..1676246 | - | 288 | Protein_1579 | DnaJ domain-containing protein | - |
QLQ52_RS08030 (1676266) | 1676266..1676583 | - | 318 | WP_002333463.1 | hypothetical protein | - |
QLQ52_RS08035 (1677024) | 1677024..1677887 | - | 864 | WP_002401483.1 | zeta toxin family protein | Toxin |
QLQ52_RS08040 (1677889) | 1677889..1678161 | - | 273 | WP_000301765.1 | antitoxin | Antitoxin |
QLQ52_RS08045 (1678178) | 1678178..1678393 | - | 216 | WP_002295735.1 | peptide-binding protein | - |
QLQ52_RS08050 (1678492) | 1678492..1679388 | - | 897 | WP_002387620.1 | ParA family protein | - |
QLQ52_RS08055 (1679491) | 1679491..1679751 | - | 261 | Protein_1585 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
QLQ52_RS08060 (1679921) | 1679921..1680658 | - | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
QLQ52_RS08065 (1680783) | 1680783..1680878 | - | 96 | WP_001809736.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
QLQ52_RS08070 (1680947) | 1680947..1681069 | - | 123 | Protein_1588 | peptide-binding protein | - |
QLQ52_RS08075 (1681189) | 1681189..1682715 | - | 1527 | WP_025191980.1 | type IA DNA topoisomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | erm(B) / ant(6)-Ia / lnu(B) / lsa(E) / aph(3')-III / aac(6')-aph(2'') | - | 1675205..1709601 | 34396 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32486.06 Da Isoelectric Point: 6.9965
>T281582 WP_002401483.1 NZ_CP124898:c1677887-1677024 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSRLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMLQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSRLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMLQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|