Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 1237216..1237909 | Replicon | chromosome |
| Accession | NZ_CP124898 | ||
| Organism | Enterococcus faecalis strain EfsC109-2 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | S4BLV4 |
| Locus tag | QLQ52_RS05800 | Protein ID | WP_002378467.1 |
| Coordinates | 1237216..1237560 (-) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | QLQ52_RS05805 | Protein ID | WP_002364355.1 |
| Coordinates | 1237577..1237909 (-) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ52_RS05770 (1232490) | 1232490..1233458 | + | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
| QLQ52_RS05775 (1233415) | 1233415..1234461 | + | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| QLQ52_RS05780 (1234461) | 1234461..1234736 | + | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | - |
| QLQ52_RS05785 (1234733) | 1234733..1235167 | + | 435 | Protein_1134 | competence type IV pilus minor pilin ComGD | - |
| QLQ52_RS05790 (1235204) | 1235204..1236352 | - | 1149 | WP_002378469.1 | site-specific integrase | - |
| QLQ52_RS05795 (1236452) | 1236452..1237180 | - | 729 | WP_002378468.1 | potassium channel family protein | - |
| QLQ52_RS05800 (1237216) | 1237216..1237560 | - | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| QLQ52_RS05805 (1237577) | 1237577..1237909 | - | 333 | WP_002364355.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QLQ52_RS05810 (1238221) | 1238221..1238397 | + | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| QLQ52_RS05815 (1238408) | 1238408..1238719 | + | 312 | WP_002381719.1 | hypothetical protein | - |
| QLQ52_RS05820 (1238758) | 1238758..1239483 | + | 726 | WP_002378466.1 | phage regulatory protein | - |
| QLQ52_RS05825 (1239509) | 1239509..1239697 | - | 189 | WP_002357001.1 | YegP family protein | - |
| QLQ52_RS05830 (1239752) | 1239752..1239961 | + | 210 | WP_002378465.1 | hypothetical protein | - |
| QLQ52_RS05835 (1239998) | 1239998..1240192 | + | 195 | WP_002378464.1 | hypothetical protein | - |
| QLQ52_RS05840 (1240619) | 1240619..1241173 | - | 555 | WP_002357006.1 | hypothetical protein | - |
| QLQ52_RS05845 (1241393) | 1241393..1241710 | + | 318 | WP_002357007.1 | hypothetical protein | - |
| QLQ52_RS05850 (1241703) | 1241703..1242437 | + | 735 | WP_002378463.1 | ERF family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1234760..1283636 | 48876 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13712.62 Da Isoelectric Point: 5.5523
>T281581 WP_002378467.1 NZ_CP124898:c1237560-1237216 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|