Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2847075..2847646 | Replicon | chromosome |
Accession | NZ_CP124894 | ||
Organism | Enterococcus faecalis strain EfsC116 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | R3GRA7 |
Locus tag | QLQ63_RS13885 | Protein ID | WP_002360937.1 |
Coordinates | 2847075..2847416 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3JGB1 |
Locus tag | QLQ63_RS13890 | Protein ID | WP_002354773.1 |
Coordinates | 2847416..2847646 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ63_RS13880 (2843090) | 2843090..2846704 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
QLQ63_RS13885 (2847075) | 2847075..2847416 | - | 342 | WP_002360937.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QLQ63_RS13890 (2847416) | 2847416..2847646 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
QLQ63_RS13895 (2848053) | 2848053..2848268 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
QLQ63_RS13900 (2848407) | 2848407..2849399 | + | 993 | WP_023894581.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
QLQ63_RS13905 (2849663) | 2849663..2850301 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
QLQ63_RS13910 (2850987) | 2850987..2852603 | + | 1617 | WP_047648929.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13165.41 Da Isoelectric Point: 9.3988
>T281561 WP_002360937.1 NZ_CP124894:c2847416-2847075 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2A7G9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2A812 |