Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1830662..1831355 Replicon chromosome
Accession NZ_CP124894
Organism Enterococcus faecalis strain EfsC116

Toxin (Protein)


Gene name IrrE Uniprot ID S4BLV4
Locus tag QLQ63_RS09115 Protein ID WP_002378467.1
Coordinates 1831011..1831355 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag QLQ63_RS09110 Protein ID WP_002364355.1
Coordinates 1830662..1830994 (+) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ63_RS09065 (1826134) 1826134..1826868 - 735 WP_002381724.1 ERF family protein -
QLQ63_RS09070 (1826861) 1826861..1827178 - 318 WP_002401330.1 hypothetical protein -
QLQ63_RS09075 (1827398) 1827398..1827952 + 555 WP_002357006.1 hypothetical protein -
QLQ63_RS09080 (1828379) 1828379..1828573 - 195 WP_002381722.1 hypothetical protein -
QLQ63_RS09085 (1828610) 1828610..1828819 - 210 WP_002381721.1 hypothetical protein -
QLQ63_RS09090 (1828874) 1828874..1829062 + 189 WP_002357001.1 YegP family protein -
QLQ63_RS09095 (1829088) 1829088..1829813 - 726 WP_002381720.1 phage regulatory protein -
QLQ63_RS09100 (1829852) 1829852..1830163 - 312 WP_002381719.1 hypothetical protein -
QLQ63_RS09105 (1830174) 1830174..1830350 - 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
QLQ63_RS09110 (1830662) 1830662..1830994 + 333 WP_002364355.1 helix-turn-helix transcriptional regulator Antitoxin
QLQ63_RS09115 (1831011) 1831011..1831355 + 345 WP_002378467.1 ImmA/IrrE family metallo-endopeptidase Toxin
QLQ63_RS09120 (1831391) 1831391..1832119 + 729 WP_002381717.1 potassium channel family protein -
QLQ63_RS09125 (1832219) 1832219..1833367 + 1149 WP_002381716.1 site-specific integrase -
QLQ63_RS09130 (1833395) 1833395..1833838 - 444 WP_002381715.1 competence type IV pilus minor pilin ComGD -
QLQ63_RS09135 (1833835) 1833835..1834110 - 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
QLQ63_RS09140 (1834110) 1834110..1835156 - 1047 WP_047649127.1 competence type IV pilus assembly protein ComGB -
QLQ63_RS09145 (1835113) 1835113..1836081 - 969 WP_002401324.1 competence type IV pilus ATPase ComGA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1784672..1833811 49139


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-89)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-63)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13712.62 Da        Isoelectric Point: 5.5523

>T281548 WP_002378467.1 NZ_CP124894:1831011-1831355 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12691.16 Da        Isoelectric Point: 4.6307

>AT281548 WP_002364355.1 NZ_CP124894:1830662-1830994 [Enterococcus faecalis]
MNLLERIKKLAKDRDVSIYQLEEEINIGRNTIYQWNKRTPSSDKLEAVANYFNVSVDYLLGRTENPNQAGAKPSDDLDEV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S4BLV4

Antitoxin

Source ID Structure

References