Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
Location | 1802335..1803028 | Replicon | chromosome |
Accession | NZ_CP124893 | ||
Organism | Enterococcus faecalis strain EfsC123 |
Toxin (Protein)
Gene name | IrrE | Uniprot ID | S4BLV4 |
Locus tag | QLQ42_RS08850 | Protein ID | WP_002378467.1 |
Coordinates | 1802684..1803028 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | ImmA | Uniprot ID | - |
Locus tag | QLQ42_RS08845 | Protein ID | WP_002364355.1 |
Coordinates | 1802335..1802667 (+) | Length | 111 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ42_RS08800 (1797807) | 1797807..1798541 | - | 735 | WP_002378463.1 | ERF family protein | - |
QLQ42_RS08805 (1798534) | 1798534..1798851 | - | 318 | WP_002357007.1 | hypothetical protein | - |
QLQ42_RS08810 (1799071) | 1799071..1799625 | + | 555 | WP_002357006.1 | hypothetical protein | - |
QLQ42_RS08815 (1800052) | 1800052..1800246 | - | 195 | WP_002378464.1 | hypothetical protein | - |
QLQ42_RS08820 (1800283) | 1800283..1800492 | - | 210 | WP_002378465.1 | hypothetical protein | - |
QLQ42_RS08825 (1800547) | 1800547..1800735 | + | 189 | WP_002357001.1 | YegP family protein | - |
QLQ42_RS08830 (1800761) | 1800761..1801486 | - | 726 | WP_002378466.1 | phage regulatory protein | - |
QLQ42_RS08835 (1801525) | 1801525..1801836 | - | 312 | WP_002381719.1 | hypothetical protein | - |
QLQ42_RS08840 (1801847) | 1801847..1802023 | - | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
QLQ42_RS08845 (1802335) | 1802335..1802667 | + | 333 | WP_002364355.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QLQ42_RS08850 (1802684) | 1802684..1803028 | + | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
QLQ42_RS08855 (1803064) | 1803064..1803792 | + | 729 | WP_002378468.1 | potassium channel family protein | - |
QLQ42_RS08860 (1803892) | 1803892..1805040 | + | 1149 | WP_002378469.1 | site-specific integrase | - |
QLQ42_RS08865 (1805077) | 1805077..1805511 | - | 435 | Protein_1715 | competence type IV pilus minor pilin ComGD | - |
QLQ42_RS08870 (1805508) | 1805508..1805783 | - | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | - |
QLQ42_RS08875 (1805783) | 1805783..1806829 | - | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
QLQ42_RS08880 (1806786) | 1806786..1807754 | - | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1765997..1805484 | 39487 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13712.62 Da Isoelectric Point: 5.5523
>T281536 WP_002378467.1 NZ_CP124893:1802684-1803028 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|