281533

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-DinJ
Location 395175..395709 Replicon chromosome
Accession NZ_CP124893
Organism Enterococcus faecalis strain EfsC123

Toxin (Protein)


Gene name relE Uniprot ID R3JX52
Locus tag QLQ42_RS02015 Protein ID WP_002360769.1
Coordinates 395434..395709 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID R3H6P0
Locus tag QLQ42_RS02010 Protein ID WP_002369771.1
Coordinates 395175..395441 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ42_RS01975 (391225) 391225..391818 + 594 WP_002414802.1 replication-relaxation family protein -
QLQ42_RS01980 (391824) 391824..392312 + 489 WP_010710133.1 hypothetical protein -
QLQ42_RS01985 (392904) 392904..393170 + 267 WP_002377947.1 hypothetical protein -
QLQ42_RS01990 (393203) 393203..393703 + 501 WP_002360775.1 DnaJ domain-containing protein -
QLQ42_RS01995 (393716) 393716..393964 + 249 WP_002360773.1 DUF3850 domain-containing protein -
QLQ42_RS02000 (394040) 394040..394456 + 417 WP_010710134.1 single-stranded DNA-binding protein -
QLQ42_RS02005 (394480) 394480..395064 + 585 WP_002377949.1 thermonuclease family protein -
QLQ42_RS02010 (395175) 395175..395441 + 267 WP_002369771.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QLQ42_RS02015 (395434) 395434..395709 + 276 WP_002360769.1 type II toxin-antitoxin system YafQ family toxin Toxin
QLQ42_RS02020 (395900) 395900..396544 - 645 WP_002377952.1 IS6 family transposase -
QLQ42_RS02025 (396677) 396677..397559 + 883 Protein_375 IS256 family transposase -
QLQ42_RS02030 (397864) 397864..398901 - 1038 WP_002355369.1 PTS sugar transporter subunit IIC -
QLQ42_RS02035 (398927) 398927..399865 - 939 WP_002370935.1 2-dehydropantoate 2-reductase -
QLQ42_RS02040 (399993) 399993..400322 - 330 WP_002358661.1 LPXTG cell wall anchor domain-containing protein -
QLQ42_RS02045 (400352) 400352..400537 + 186 WP_282896948.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - bsh / cylR2 / cylR1 / cylL / cylS / cylM / cylB / cylA / cylI / esp 374085..433230 59145


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-86)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10732.58 Da        Isoelectric Point: 9.6918

>T281533 WP_002360769.1 NZ_CP124893:395434-395709 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR

Download         Length: 276 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9772.09 Da        Isoelectric Point: 4.4791

>AT281533 WP_002369771.1 NZ_CP124893:395175-395441 [Enterococcus faecalis]
VATTKKKPIHVNVDENLKEEAEQLFDDLGLNMTSAITIFLKQSINEQAIPFMINKGNKETLQALKDIKEGNVHGGFSSVE
DLMEDLNA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M2AEA7

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AED7

References