Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 1622710..1623292 | Replicon | chromosome |
Accession | NZ_CP124889 | ||
Organism | Enterococcus faecalis strain EfsPF5 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | A0A0M2AE74 |
Locus tag | QLQ34_RS08010 | Protein ID | WP_002355414.1 |
Coordinates | 1622984..1623292 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL19 |
Locus tag | QLQ34_RS08005 | Protein ID | WP_002326825.1 |
Coordinates | 1622710..1622982 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ34_RS07975 (1617991) | 1617991..1618719 | - | 729 | WP_002355404.1 | GntR family transcriptional regulator | - |
QLQ34_RS07980 (1618896) | 1618896..1619822 | + | 927 | WP_002355406.1 | hypothetical protein | - |
QLQ34_RS07985 (1619839) | 1619839..1621122 | + | 1284 | WP_002363033.1 | PTS sugar transporter subunit IIC | - |
QLQ34_RS07990 (1621314) | 1621314..1621436 | + | 123 | Protein_1546 | topoisomerase | - |
QLQ34_RS07995 (1621511) | 1621511..1622407 | + | 897 | WP_002363034.1 | ParA family protein | - |
QLQ34_RS08000 (1622484) | 1622484..1622693 | + | 210 | WP_002363035.1 | peptide-binding protein | - |
QLQ34_RS08005 (1622710) | 1622710..1622982 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
QLQ34_RS08010 (1622984) | 1622984..1623292 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
QLQ34_RS08015 (1623372) | 1623372..1623794 | - | 423 | WP_080005963.1 | tyrosine-type recombinase/integrase | - |
QLQ34_RS08020 (1623845) | 1623845..1624345 | - | 501 | WP_002363039.1 | HAD family hydrolase | - |
QLQ34_RS08025 (1624350) | 1624350..1625117 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
QLQ34_RS08030 (1625605) | 1625605..1626030 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
QLQ34_RS08035 (1626047) | 1626047..1626562 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
QLQ34_RS08040 (1626573) | 1626573..1627505 | + | 933 | WP_002363040.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | ClpL | bsh / esp / psaA | 1590524..1733628 | 143104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T281496 WP_002355414.1 NZ_CP124889:1622984-1623292 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AE74 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AF93 |