Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/Peptidase_M78-HTH_26
Location 1179494..1180192 Replicon chromosome
Accession NZ_CP124889
Organism Enterococcus faecalis strain EfsPF5

Toxin (Protein)


Gene name IrrE Uniprot ID -
Locus tag QLQ34_RS05685 Protein ID WP_002398608.1
Coordinates 1179494..1179838 (-) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag QLQ34_RS05690 Protein ID WP_002388206.1
Coordinates 1179857..1180192 (-) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ34_RS05655 (1174746) 1174746..1175714 + 969 WP_002364362.1 competence type IV pilus ATPase ComGA -
QLQ34_RS05660 (1175671) 1175671..1176717 + 1047 WP_002356990.1 competence type IV pilus assembly protein ComGB -
QLQ34_RS05665 (1176717) 1176717..1176992 + 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
QLQ34_RS05670 (1176989) 1176989..1177432 + 444 WP_002381715.1 competence type IV pilus minor pilin ComGD -
QLQ34_RS05675 (1177460) 1177460..1178608 - 1149 WP_002388210.1 site-specific integrase -
QLQ34_RS05680 (1178708) 1178708..1179436 - 729 WP_002388208.1 potassium channel family protein -
QLQ34_RS05685 (1179494) 1179494..1179838 - 345 WP_002398608.1 ImmA/IrrE family metallo-endopeptidase Toxin
QLQ34_RS05690 (1179857) 1179857..1180192 - 336 WP_002388206.1 helix-turn-helix transcriptional regulator Antitoxin
QLQ34_RS05695 (1180484) 1180484..1180666 + 183 WP_002388205.1 hypothetical protein -
QLQ34_RS05700 (1180679) 1180679..1180876 + 198 WP_010712611.1 hypothetical protein -
QLQ34_RS05705 (1181473) 1181473..1181784 + 312 WP_002381719.1 hypothetical protein -
QLQ34_RS05710 (1181823) 1181823..1182548 + 726 WP_025187960.1 ORF6C domain-containing protein -
QLQ34_RS05715 (1182588) 1182588..1182770 - 183 WP_002364224.1 YegP family protein -
QLQ34_RS05720 (1182823) 1182823..1183017 + 195 WP_002364223.1 hypothetical protein -
QLQ34_RS05725 (1183008) 1183008..1183193 + 186 WP_002364222.1 hypothetical protein -
QLQ34_RS05730 (1183237) 1183237..1183560 + 324 WP_002380444.1 hypothetical protein -
QLQ34_RS05735 (1183560) 1183560..1183787 + 228 WP_002364220.1 hypothetical protein -
QLQ34_RS05740 (1183885) 1183885..1184826 + 942 WP_002364219.1 YqaJ viral recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1177016..1226533 49517


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(21-86)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-60)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13595.49 Da        Isoelectric Point: 4.9570

>T281495 WP_002398608.1 NZ_CP124889:c1179838-1179494 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPTEQEEAIYHELKHVEDHVDIMALYKIPVFRSKMESEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKTGQEIYLK

Download         Length: 345 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12842.51 Da        Isoelectric Point: 5.2926

>AT281495 WP_002388206.1 NZ_CP124889:c1180192-1179857 [Enterococcus faecalis]
MTVFDRIKLLAKERGKSLNRIEEELGLPKNVLYRMKTSDNPTKDRLETLANYFDVSVDYLLGRTDNTKATDEKKSDDLDD
VLDNVMSFDGKPLDDHDREVIRAYLKGRFGK

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References