Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 28925..29496 Replicon plasmid p1_EfsPNK7_rep7a
Accession NZ_CP124888
Organism Enterococcus faecalis strain EfsPNK7

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag QLQ46_RS13770 Protein ID WP_002362432.1
Coordinates 29155..29496 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag QLQ46_RS13765 Protein ID WP_002362431.1
Coordinates 28925..29155 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ46_RS13725 (24869) 24869..25168 - 300 WP_010817802.1 hypothetical protein -
- (25277) 25277..25368 + 92 NuclAT_0 - -
- (25277) 25277..25368 + 92 NuclAT_0 - -
- (25277) 25277..25368 + 92 NuclAT_0 - -
- (25277) 25277..25368 + 92 NuclAT_0 - -
- (25304) 25304..25368 + 65 NuclAT_1 - -
QLQ46_RS13730 (25408) 25408..25497 - 90 WP_153829630.1 type I toxin-antitoxin system Fst family toxin -
QLQ46_RS13735 (26013) 26013..26330 + 318 WP_002394802.1 heavy metal-binding domain-containing protein -
QLQ46_RS13740 (26366) 26366..27034 + 669 WP_002403283.1 CPBP family intramembrane metalloprotease -
QLQ46_RS13745 (27151) 27151..27405 + 255 WP_002394800.1 hypothetical protein -
QLQ46_RS13750 (27565) 27565..27798 - 234 WP_002394799.1 hypothetical protein -
QLQ46_RS13755 (27800) 27800..28084 - 285 WP_002394798.1 hypothetical protein -
QLQ46_RS13760 (28101) 28101..28721 - 621 WP_161971471.1 recombinase family protein -
QLQ46_RS13765 (28925) 28925..29155 + 231 WP_002362431.1 hypothetical protein Antitoxin
QLQ46_RS13770 (29155) 29155..29496 + 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
QLQ46_RS13775 (29608) 29608..30546 + 939 WP_002362433.1 hypothetical protein -
QLQ46_RS13780 (30811) 30811..31413 + 603 WP_002362434.1 Fic family protein -
QLQ46_RS13785 (31552) 31552..32708 + 1157 WP_100815066.1 IS3 family transposase -
QLQ46_RS13790 (33147) 33147..33995 - 849 WP_001258486.1 streptomycin adenylyltransferase Str -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid str / dfrG prgB/asc10 1..69286 69286


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T281476 WP_002362432.1 NZ_CP124888:29155-29496 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT281476 WP_002362431.1 NZ_CP124888:28925-29155 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References