Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2754281..2754852 | Replicon | chromosome |
| Accession | NZ_CP124887 | ||
| Organism | Enterococcus faecalis strain EfsPNK7 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | R3GRA7 |
| Locus tag | QLQ46_RS13155 | Protein ID | WP_002360937.1 |
| Coordinates | 2754281..2754622 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3JGB1 |
| Locus tag | QLQ46_RS13160 | Protein ID | WP_002354773.1 |
| Coordinates | 2754622..2754852 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ46_RS13150 (2750041) | 2750041..2753655 | - | 3615 | WP_010712913.1 | DNA-directed RNA polymerase subunit beta | - |
| QLQ46_RS13155 (2754281) | 2754281..2754622 | - | 342 | WP_002360937.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QLQ46_RS13160 (2754622) | 2754622..2754852 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
| QLQ46_RS13165 (2755258) | 2755258..2755473 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| QLQ46_RS13170 (2755612) | 2755612..2756604 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| QLQ46_RS13175 (2756671) | 2756671..2757303 | - | 633 | WP_002358972.1 | RloB family protein | - |
| QLQ46_RS13180 (2757312) | 2757312..2758607 | - | 1296 | WP_010713676.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13165.41 Da Isoelectric Point: 9.3988
>T281474 WP_002360937.1 NZ_CP124887:c2754622-2754281 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2A7G9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2A812 |