Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 339727..340864 | Replicon | chromosome |
Accession | NZ_CP124887 | ||
Organism | Enterococcus faecalis strain EfsPNK7 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | QLQ46_RS01750 | Protein ID | WP_002401483.1 |
Coordinates | 339727..340590 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | QLQ46_RS01755 | Protein ID | WP_000301765.1 |
Coordinates | 340592..340864 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ46_RS01710 (335003) | 335003..335251 | - | 249 | WP_002328891.1 | helix-turn-helix transcriptional regulator | - |
QLQ46_RS01715 (335723) | 335723..336460 | - | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
QLQ46_RS01720 (336585) | 336585..336668 | - | 84 | WP_032501549.1 | 23S rRNA methyltransferase attenuator leader peptide ErmL | - |
QLQ46_RS01725 (336717) | 336717..336800 | - | 84 | Protein_315 | MLS leader peptide | - |
QLQ46_RS01730 (337123) | 337123..337803 | + | 681 | WP_010713039.1 | IS6-like element IS1216 family transposase | - |
QLQ46_RS01735 (337887) | 337887..338303 | - | 417 | WP_025192327.1 | DpnD/PcfM family protein | - |
QLQ46_RS01740 (338245) | 338245..338742 | - | 498 | WP_010713926.1 | molecular chaperone DnaJ | - |
QLQ46_RS01745 (339276) | 339276..339593 | - | 318 | WP_002338433.1 | hypothetical protein | - |
QLQ46_RS01750 (339727) | 339727..340590 | - | 864 | WP_002401483.1 | zeta toxin family protein | Toxin |
QLQ46_RS01755 (340592) | 340592..340864 | - | 273 | WP_000301765.1 | antitoxin | Antitoxin |
QLQ46_RS01760 (340881) | 340881..341096 | - | 216 | WP_002295735.1 | peptide-binding protein | - |
QLQ46_RS01765 (341195) | 341195..342091 | - | 897 | WP_282859237.1 | ParA family protein | - |
QLQ46_RS01770 (342194) | 342194..342724 | - | 531 | Protein_324 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
QLQ46_RS01775 (342760) | 342760..343161 | + | 402 | WP_160160814.1 | protein rep | - |
QLQ46_RS01780 (343361) | 343361..344737 | + | 1377 | WP_002294500.1 | tetracycline efflux MFS transporter Tet(L) | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | tet(L) / ant(6)-Ia / aac(6')-aph(2'') / erm(B) | - | 343361..354545 | 11184 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32486.06 Da Isoelectric Point: 6.9965
>T281461 WP_002401483.1 NZ_CP124887:c340590-339727 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSRLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMLQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSRLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMLQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|