Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2732373..2732944 | Replicon | chromosome |
| Accession | NZ_CP124886 | ||
| Organism | Enterococcus faecalis strain EfsPF13 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | QLQ55_RS13310 | Protein ID | WP_002354774.1 |
| Coordinates | 2732373..2732714 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3JGB1 |
| Locus tag | QLQ55_RS13315 | Protein ID | WP_002354773.1 |
| Coordinates | 2732714..2732944 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ55_RS13305 (2728388) | 2728388..2732002 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
| QLQ55_RS13310 (2732373) | 2732373..2732714 | - | 342 | WP_002354774.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QLQ55_RS13315 (2732714) | 2732714..2732944 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
| QLQ55_RS13320 (2733120) | 2733120..2733335 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| QLQ55_RS13325 (2733474) | 2733474..2734466 | + | 993 | WP_002354765.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| QLQ55_RS13330 (2734730) | 2734730..2735359 | - | 630 | WP_002354763.1 | lytic polysaccharide monooxygenase | - |
| QLQ55_RS13335 (2736052) | 2736052..2737668 | + | 1617 | WP_002381036.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13156.40 Da Isoelectric Point: 9.3984
>T281447 WP_002354774.1 NZ_CP124886:c2732714-2732373 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|