Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 417903..418485 | Replicon | chromosome |
| Accession | NZ_CP124886 | ||
| Organism | Enterococcus faecalis strain EfsPF13 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | A0A0M2AE74 |
| Locus tag | QLQ55_RS02140 | Protein ID | WP_002355414.1 |
| Coordinates | 418177..418485 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | Q9AL19 |
| Locus tag | QLQ55_RS02135 | Protein ID | WP_002326825.1 |
| Coordinates | 417903..418175 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ55_RS02105 (413184) | 413184..413912 | - | 729 | WP_002355404.1 | GntR family transcriptional regulator | - |
| QLQ55_RS02110 (414089) | 414089..415015 | + | 927 | WP_002355406.1 | hypothetical protein | - |
| QLQ55_RS02115 (415032) | 415032..416315 | + | 1284 | WP_002363033.1 | PTS sugar transporter subunit IIC | - |
| QLQ55_RS02120 (416507) | 416507..416629 | + | 123 | Protein_394 | topoisomerase | - |
| QLQ55_RS02125 (416704) | 416704..417600 | + | 897 | WP_002363034.1 | ParA family protein | - |
| QLQ55_RS02130 (417677) | 417677..417886 | + | 210 | WP_002363035.1 | peptide-binding protein | - |
| QLQ55_RS02135 (417903) | 417903..418175 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
| QLQ55_RS02140 (418177) | 418177..418485 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
| QLQ55_RS02145 (418565) | 418565..418987 | - | 423 | WP_080005963.1 | tyrosine-type recombinase/integrase | - |
| QLQ55_RS02150 (419038) | 419038..419538 | - | 501 | WP_002363039.1 | HAD family hydrolase | - |
| QLQ55_RS02155 (419543) | 419543..420310 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| QLQ55_RS02160 (420799) | 420799..421224 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
| QLQ55_RS02165 (421241) | 421241..421756 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
| QLQ55_RS02170 (421767) | 421767..422699 | + | 933 | WP_002363040.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | ClpL | bsh / esp / psaA | 385718..498640 | 112922 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T281433 WP_002355414.1 NZ_CP124886:418177-418485 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AE74 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AF93 |