Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 2458830..2459866 | Replicon | chromosome |
| Accession | NZ_CP124884 | ||
| Organism | Enterococcus faecalis strain EfsPF15 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | - |
| Locus tag | QLQ47_RS11815 | Protein ID | WP_156209341.1 |
| Coordinates | 2459213..2459866 (+) | Length | 218 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | R3K8V7 |
| Locus tag | QLQ47_RS11810 | Protein ID | WP_002371437.1 |
| Coordinates | 2458830..2459216 (+) | Length | 129 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ47_RS11760 (2454647) | 2454647..2455015 | - | 369 | WP_002365216.1 | DUF86 domain-containing protein | - |
| QLQ47_RS11765 (2454999) | 2454999..2455331 | - | 333 | WP_002399122.1 | nucleotidyltransferase domain-containing protein | - |
| QLQ47_RS11770 (2455391) | 2455391..2455693 | - | 303 | WP_224580387.1 | hypothetical protein | - |
| QLQ47_RS11775 (2455754) | 2455754..2455993 | - | 240 | WP_002365219.1 | hypothetical protein | - |
| QLQ47_RS11780 (2456004) | 2456004..2456156 | - | 153 | WP_002365221.1 | hypothetical protein | - |
| QLQ47_RS11785 (2456183) | 2456183..2456407 | - | 225 | WP_002365222.1 | hypothetical protein | - |
| QLQ47_RS11790 (2456814) | 2456814..2456975 | - | 162 | WP_002365224.1 | hypothetical protein | - |
| QLQ47_RS11795 (2456998) | 2456998..2457414 | - | 417 | WP_002380876.1 | DUF961 family protein | - |
| QLQ47_RS11800 (2457414) | 2457414..2457740 | - | 327 | WP_002365226.1 | hypothetical protein | - |
| QLQ47_RS11805 (2457826) | 2457826..2458077 | - | 252 | WP_002365227.1 | hypothetical protein | - |
| QLQ47_RS11810 (2458830) | 2458830..2459216 | + | 387 | WP_002371437.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QLQ47_RS11815 (2459213) | 2459213..2459866 | + | 654 | WP_156209341.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| QLQ47_RS11820 (2459905) | 2459905..2460240 | + | 336 | WP_002365231.1 | helix-turn-helix domain-containing protein | - |
| QLQ47_RS11825 (2460278) | 2460278..2461609 | - | 1332 | WP_282851321.1 | FAD-dependent oxidoreductase | - |
| QLQ47_RS11830 (2461708) | 2461708..2462643 | - | 936 | WP_171803825.1 | aldo/keto reductase | - |
| QLQ47_RS11835 (2462658) | 2462658..2463077 | - | 420 | WP_002365234.1 | MerR family transcriptional regulator | - |
| QLQ47_RS11840 (2463094) | 2463094..2463675 | - | 582 | WP_002380883.1 | histidine phosphatase family protein | - |
| QLQ47_RS11845 (2463897) | 2463897..2464226 | + | 330 | WP_002365236.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2393545..2460123 | 66578 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 218 a.a. Molecular weight: 26034.98 Da Isoelectric Point: 6.2394
>T281410 WP_156209341.1 NZ_CP124884:2459213-2459866 [Enterococcus faecalis]
MIGLLLVDFISKELYFEAFNFSNELIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDE
VIIATNKELMLERKNFTKMHEVMHYYIDIPKINNATHTFSDILLKNGYLMEDFPKEYRANVGASMLMANDQALFYALKKF
YSFEEIAQYFFMSKSALRNRLIEHLMYVNNCTFAHANTLFNNYYFHKETDIYRFIFN
MIGLLLVDFISKELYFEAFNFSNELIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDE
VIIATNKELMLERKNFTKMHEVMHYYIDIPKINNATHTFSDILLKNGYLMEDFPKEYRANVGASMLMANDQALFYALKKF
YSFEEIAQYFFMSKSALRNRLIEHLMYVNNCTFAHANTLFNNYYFHKETDIYRFIFN
Download Length: 654 bp
Antitoxin
Download Length: 129 a.a. Molecular weight: 15180.07 Da Isoelectric Point: 4.9147
>AT281410 WP_002371437.1 NZ_CP124884:2458830-2459216 [Enterococcus faecalis]
VTIIKTNERLKQLRENKELTQKELADLLHMDRSVYNKIESGARPIRDNELIQFADFYNVSTDYLTNRTNNPIPPEEKTNV
GQNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKERNKKN
VTIIKTNERLKQLRENKELTQKELADLLHMDRSVYNKIESGARPIRDNELIQFADFYNVSTDYLTNRTNNPIPPEEKTNV
GQNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKERNKKN
Download Length: 387 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|