Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1801217..1801910 Replicon chromosome
Accession NZ_CP124884
Organism Enterococcus faecalis strain EfsPF15

Toxin (Protein)


Gene name IrrE Uniprot ID S4BLV4
Locus tag QLQ47_RS08730 Protein ID WP_002378467.1
Coordinates 1801566..1801910 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag QLQ47_RS08725 Protein ID WP_002364355.1
Coordinates 1801217..1801549 (+) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ47_RS08680 (1796689) 1796689..1797423 - 735 WP_002381724.1 ERF family protein -
QLQ47_RS08685 (1797416) 1797416..1797733 - 318 WP_002401330.1 hypothetical protein -
QLQ47_RS08690 (1797953) 1797953..1798507 + 555 WP_002357006.1 hypothetical protein -
QLQ47_RS08695 (1798934) 1798934..1799128 - 195 WP_002381722.1 hypothetical protein -
QLQ47_RS08700 (1799165) 1799165..1799374 - 210 WP_002381721.1 hypothetical protein -
QLQ47_RS08705 (1799429) 1799429..1799617 + 189 WP_002357001.1 YegP family protein -
QLQ47_RS08710 (1799643) 1799643..1800368 - 726 WP_002381720.1 phage regulatory protein -
QLQ47_RS08715 (1800407) 1800407..1800718 - 312 WP_002381719.1 hypothetical protein -
QLQ47_RS08720 (1800729) 1800729..1800905 - 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
QLQ47_RS08725 (1801217) 1801217..1801549 + 333 WP_002364355.1 helix-turn-helix transcriptional regulator Antitoxin
QLQ47_RS08730 (1801566) 1801566..1801910 + 345 WP_002378467.1 ImmA/IrrE family metallo-endopeptidase Toxin
QLQ47_RS08735 (1801946) 1801946..1802674 + 729 WP_002381717.1 potassium channel family protein -
QLQ47_RS08740 (1802774) 1802774..1803922 + 1149 WP_002381716.1 site-specific integrase -
QLQ47_RS08745 (1803950) 1803950..1804393 - 444 WP_002381715.1 competence type IV pilus minor pilin ComGD -
QLQ47_RS08750 (1804390) 1804390..1804665 - 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
QLQ47_RS08755 (1804665) 1804665..1805711 - 1047 WP_047649127.1 competence type IV pilus assembly protein ComGB -
QLQ47_RS08760 (1805668) 1805668..1806636 - 969 WP_002401324.1 competence type IV pilus ATPase ComGA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1755227..1804366 49139


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-89)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-63)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13712.62 Da        Isoelectric Point: 5.5523

>T281409 WP_002378467.1 NZ_CP124884:1801566-1801910 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12691.16 Da        Isoelectric Point: 4.6307

>AT281409 WP_002364355.1 NZ_CP124884:1801217-1801549 [Enterococcus faecalis]
MNLLERIKKLAKDRDVSIYQLEEEINIGRNTIYQWNKRTPSSDKLEAVANYFNVSVDYLLGRTENPNQAGAKPSDDLDEV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S4BLV4

Antitoxin

Source ID Structure

References