Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-DinJ
Location 11430..11964 Replicon plasmid p1_EfsPF20_rep9a
Accession NZ_CP124883
Organism Enterococcus faecalis strain EfsPF20

Toxin (Protein)


Gene name relE Uniprot ID R3JX52
Locus tag QLQ60_RS14420 Protein ID WP_002360769.1
Coordinates 11689..11964 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID R3H6P0
Locus tag QLQ60_RS14415 Protein ID WP_002369771.1
Coordinates 11430..11696 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ60_RS14380 (7288) 7288..8073 + 786 WP_002360778.1 replication-relaxation family protein -
QLQ60_RS14385 (8079) 8079..8567 + 489 WP_002412099.1 hypothetical protein -
QLQ60_RS14390 (9159) 9159..9425 + 267 WP_002360776.1 hypothetical protein -
QLQ60_RS14395 (9458) 9458..9958 + 501 WP_002360775.1 DnaJ domain-containing protein -
QLQ60_RS14400 (9971) 9971..10219 + 249 WP_002360773.1 DUF3850 domain-containing protein -
QLQ60_RS14405 (10295) 10295..10711 + 417 WP_002414801.1 single-stranded DNA-binding protein -
QLQ60_RS14410 (10735) 10735..11319 + 585 WP_002383617.1 thermonuclease family protein -
QLQ60_RS14415 (11430) 11430..11696 + 267 WP_002369771.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QLQ60_RS14420 (11689) 11689..11964 + 276 WP_002360769.1 type II toxin-antitoxin system YafQ family toxin Toxin
QLQ60_RS14425 (12769) 12769..12954 + 186 WP_002368099.1 hypothetical protein -
QLQ60_RS14430 (12939) 12939..13130 + 192 WP_002383620.1 DpnD/PcfM family protein -
QLQ60_RS14435 (13362) 13362..14141 + 780 WP_002383621.1 Cas9 inhibitor AcrIIA9 family protein -
QLQ60_RS14440 (14141) 14141..15400 + 1260 WP_002360763.1 PcfJ domain-containing protein -
QLQ60_RS14445 (15997) 15997..16725 + 729 WP_002383622.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..53449 53449


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-86)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10732.58 Da        Isoelectric Point: 9.6918

>T281401 WP_002360769.1 NZ_CP124883:11689-11964 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR

Download         Length: 276 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9772.09 Da        Isoelectric Point: 4.4791

>AT281401 WP_002369771.1 NZ_CP124883:11430-11696 [Enterococcus faecalis]
VATTKKKPIHVNVDENLKEEAEQLFDDLGLNMTSAITIFLKQSINEQAIPFMINKGNKETLQALKDIKEGNVHGGFSSVE
DLMEDLNA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M2AEA7

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AED7

References