Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2835455..2836026 | Replicon | chromosome |
| Accession | NZ_CP124882 | ||
| Organism | Enterococcus faecalis strain EfsPF20 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | QLQ60_RS13775 | Protein ID | WP_010785112.1 |
| Coordinates | 2835455..2835796 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3JGB1 |
| Locus tag | QLQ60_RS13780 | Protein ID | WP_002354773.1 |
| Coordinates | 2835796..2836026 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ60_RS13770 (2831470) | 2831470..2835084 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
| QLQ60_RS13775 (2835455) | 2835455..2835796 | - | 342 | WP_010785112.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QLQ60_RS13780 (2835796) | 2835796..2836026 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
| QLQ60_RS13785 (2836433) | 2836433..2836648 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| QLQ60_RS13790 (2836787) | 2836787..2837779 | + | 993 | WP_002365428.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| QLQ60_RS13795 (2837846) | 2837846..2838478 | - | 633 | WP_002358972.1 | RloB family protein | - |
| QLQ60_RS13800 (2838487) | 2838487..2839782 | - | 1296 | WP_002371641.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13103.35 Da Isoelectric Point: 8.4667
>T281397 WP_010785112.1 NZ_CP124882:c2835796-2835455 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRCPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRCPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|