Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 2477394..2478430 | Replicon | chromosome |
| Accession | NZ_CP124882 | ||
| Organism | Enterococcus faecalis strain EfsPF20 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | - |
| Locus tag | QLQ60_RS12065 | Protein ID | WP_002371439.1 |
| Coordinates | 2477777..2478430 (+) | Length | 218 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | R3K8V7 |
| Locus tag | QLQ60_RS12060 | Protein ID | WP_002371437.1 |
| Coordinates | 2477394..2477780 (+) | Length | 129 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ60_RS12020 (2473735) | 2473735..2474115 | - | 381 | WP_002371429.1 | DUF86 domain-containing protein | - |
| QLQ60_RS12025 (2474105) | 2474105..2474431 | - | 327 | WP_002393071.1 | nucleotidyltransferase domain-containing protein | - |
| QLQ60_RS12030 (2474491) | 2474491..2474805 | - | 315 | WP_002371431.1 | hypothetical protein | - |
| QLQ60_RS12035 (2474825) | 2474825..2474977 | - | 153 | WP_002371433.1 | hypothetical protein | - |
| QLQ60_RS12040 (2475204) | 2475204..2475392 | + | 189 | WP_002371434.1 | hypothetical protein | - |
| QLQ60_RS12045 (2475580) | 2475580..2475978 | - | 399 | WP_002371435.1 | DUF961 family protein | - |
| QLQ60_RS12050 (2475978) | 2475978..2476304 | - | 327 | WP_002371436.1 | hypothetical protein | - |
| QLQ60_RS12055 (2476390) | 2476390..2476641 | - | 252 | WP_002365227.1 | hypothetical protein | - |
| QLQ60_RS12060 (2477394) | 2477394..2477780 | + | 387 | WP_002371437.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QLQ60_RS12065 (2477777) | 2477777..2478430 | + | 654 | WP_002371439.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| QLQ60_RS12070 (2478469) | 2478469..2478804 | + | 336 | WP_002365231.1 | helix-turn-helix domain-containing protein | - |
| QLQ60_RS12075 (2478842) | 2478842..2480173 | - | 1332 | WP_002371440.1 | FAD-dependent oxidoreductase | - |
| QLQ60_RS12080 (2480272) | 2480272..2481207 | - | 936 | WP_171803825.1 | aldo/keto reductase | - |
| QLQ60_RS12085 (2481222) | 2481222..2481641 | - | 420 | WP_002371441.1 | MerR family transcriptional regulator | - |
| QLQ60_RS12090 (2481658) | 2481658..2482239 | - | 582 | WP_002380883.1 | histidine phosphatase family protein | - |
| QLQ60_RS12095 (2482461) | 2482461..2482790 | + | 330 | WP_002365236.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2411863..2478687 | 66824 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 218 a.a. Molecular weight: 26050.98 Da Isoelectric Point: 6.2394
>T281389 WP_002371439.1 NZ_CP124882:2477777-2478430 [Enterococcus faecalis]
MIGLLLVDFISKELYFEAFNFSNELIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDE
VIVTTNKELMLERKNFTKMHEVMHYYIDIPKINNATHTFSDILLKNGYLMEDFPKEYRANVGASMLMANDQALFYALKKF
YSFEEIAQYFFMSKSALRNRLIEHLMYVNNCTFAHANTLFNNYYFHKETDIYRFIFN
MIGLLLVDFISKELYFEAFNFSNELIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDE
VIVTTNKELMLERKNFTKMHEVMHYYIDIPKINNATHTFSDILLKNGYLMEDFPKEYRANVGASMLMANDQALFYALKKF
YSFEEIAQYFFMSKSALRNRLIEHLMYVNNCTFAHANTLFNNYYFHKETDIYRFIFN
Download Length: 654 bp
Antitoxin
Download Length: 129 a.a. Molecular weight: 15180.07 Da Isoelectric Point: 4.9147
>AT281389 WP_002371437.1 NZ_CP124882:2477394-2477780 [Enterococcus faecalis]
VTIIKTNERLKQLRENKELTQKELADLLHMDRSVYNKIESGARPIRDNELIQFADFYNVSTDYLTNRTNNPIPPEEKTNV
GQNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKERNKKN
VTIIKTNERLKQLRENKELTQKELADLLHMDRSVYNKIESGARPIRDNELIQFADFYNVSTDYLTNRTNNPIPPEEKTNV
GQNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKERNKKN
Download Length: 387 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|