Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/Peptidase_M78-HTH_26
Location 1807281..1807979 Replicon chromosome
Accession NZ_CP124882
Organism Enterococcus faecalis strain EfsPF20

Toxin (Protein)


Gene name IrrE Uniprot ID A0A828QMF1
Locus tag QLQ60_RS08940 Protein ID WP_002388207.1
Coordinates 1807635..1807979 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag QLQ60_RS08935 Protein ID WP_002388206.1
Coordinates 1807281..1807616 (+) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ60_RS08890 (1802715) 1802715..1803032 - 318 WP_002357007.1 hypothetical protein -
QLQ60_RS08895 (1803252) 1803252..1803806 + 555 WP_002357006.1 hypothetical protein -
QLQ60_RS08900 (1804091) 1804091..1804429 - 339 WP_002357003.1 hypothetical protein -
QLQ60_RS08905 (1804466) 1804466..1804675 - 210 WP_002357002.1 hypothetical protein -
QLQ60_RS08910 (1804730) 1804730..1804918 + 189 WP_002357001.1 YegP family protein -
QLQ60_RS08915 (1804944) 1804944..1805666 - 723 WP_002357000.1 phage regulatory protein -
QLQ60_RS08920 (1805689) 1805689..1806000 - 312 WP_002381719.1 hypothetical protein -
QLQ60_RS08925 (1806597) 1806597..1806794 - 198 WP_010712611.1 hypothetical protein -
QLQ60_RS08930 (1806807) 1806807..1806989 - 183 WP_002388205.1 hypothetical protein -
QLQ60_RS08935 (1807281) 1807281..1807616 + 336 WP_002388206.1 helix-turn-helix transcriptional regulator Antitoxin
QLQ60_RS08940 (1807635) 1807635..1807979 + 345 WP_002388207.1 ImmA/IrrE family metallo-endopeptidase Toxin
QLQ60_RS08945 (1808037) 1808037..1808765 + 729 WP_002388208.1 potassium channel family protein -
QLQ60_RS08950 (1808865) 1808865..1810013 + 1149 WP_002388210.1 site-specific integrase -
QLQ60_RS08955 (1810041) 1810041..1810484 - 444 WP_016617790.1 competence type IV pilus minor pilin ComGD -
QLQ60_RS08960 (1810481) 1810481..1810756 - 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
QLQ60_RS08965 (1810756) 1810756..1811802 - 1047 WP_002369171.1 competence type IV pilus assembly protein ComGB -
QLQ60_RS08970 (1811759) 1811759..1812727 - 969 WP_002369168.1 competence type IV pilus ATPase ComGA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1768899..1828863 59964


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(21-86)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-60)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13625.58 Da        Isoelectric Point: 4.9570

>T281388 WP_002388207.1 NZ_CP124882:1807635-1807979 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPTEQEEAIYHELKHVEDHVDIMALYKIPVFRSKMESEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEIYLK

Download         Length: 345 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12842.51 Da        Isoelectric Point: 5.2926

>AT281388 WP_002388206.1 NZ_CP124882:1807281-1807616 [Enterococcus faecalis]
MTVFDRIKLLAKERGKSLNRIEEELGLPKNVLYRMKTSDNPTKDRLETLANYFDVSVDYLLGRTDNTKATDEKKSDDLDD
VLDNVMSFDGKPLDDHDREVIRAYLKGRFGK

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A828QMF1

Antitoxin

Source ID Structure

References