Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 390678..391260 | Replicon | chromosome |
Accession | NZ_CP124882 | ||
Organism | Enterococcus faecalis strain EfsPF20 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | A0A0M2AE74 |
Locus tag | QLQ60_RS01995 | Protein ID | WP_002355414.1 |
Coordinates | 390952..391260 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL19 |
Locus tag | QLQ60_RS01990 | Protein ID | WP_002326825.1 |
Coordinates | 390678..390950 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ60_RS01970 (385897) | 385897..386298 | - | 402 | WP_002364925.1 | sigma-70 family RNA polymerase sigma factor | - |
QLQ60_RS01975 (388251) | 388251..389413 | - | 1163 | Protein_365 | IS3 family transposase | - |
QLQ60_RS01980 (389521) | 389521..390375 | + | 855 | WP_002364921.1 | ParA family protein | - |
QLQ60_RS01985 (390446) | 390446..390661 | + | 216 | WP_002355411.1 | peptide-binding protein | - |
QLQ60_RS01990 (390678) | 390678..390950 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
QLQ60_RS01995 (390952) | 390952..391260 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
QLQ60_RS02000 (391340) | 391340..391762 | - | 423 | WP_080005963.1 | tyrosine-type recombinase/integrase | - |
QLQ60_RS02005 (391813) | 391813..392313 | - | 501 | WP_002355415.1 | HAD family hydrolase | - |
QLQ60_RS02010 (392318) | 392318..393085 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
QLQ60_RS02015 (393573) | 393573..393998 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
QLQ60_RS02020 (394015) | 394015..394530 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
QLQ60_RS02025 (394541) | 394541..395473 | + | 933 | WP_002363040.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | bsh / esp | 375896..428480 | 52584 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T281385 WP_002355414.1 NZ_CP124882:390952-391260 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AE74 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AF93 |