Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 14649..15292 Replicon plasmid p1
Accession NZ_CP124874
Organism Klebsiella pneumoniae strain K82

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag QKW38_RS25515 Protein ID WP_001044770.1
Coordinates 14649..15065 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag QKW38_RS25520 Protein ID WP_001261282.1
Coordinates 15062..15292 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QKW38_RS25490 (QKW38_25490) 10254..11138 + 885 WP_000155092.1 Mph(E) family macrolide 2'-phosphotransferase -
QKW38_RS25495 (QKW38_25495) 11497..12039 - 543 WP_004896925.1 plasmid replication DNA-binding protein -
QKW38_RS25500 (QKW38_25500) 12106..12858 - 753 Protein_12 replication initiation protein RepM -
QKW38_RS25505 (QKW38_25505) 12924..13628 + 705 WP_001067858.1 IS6-like element IS26 family transposase -
QKW38_RS25510 (QKW38_25510) 13679..14575 - 897 Protein_14 AAA family ATPase -
QKW38_RS25515 (QKW38_25515) 14649..15065 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
QKW38_RS25520 (QKW38_25520) 15062..15292 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QKW38_RS25525 (QKW38_25525) 15249..15710 + 462 WP_072202616.1 hypothetical protein -
QKW38_RS25530 (QKW38_25530) 15854..16204 + 351 WP_000493378.1 hypothetical protein -
QKW38_RS25535 (QKW38_25535) 16255..16998 + 744 WP_000129823.1 hypothetical protein -
QKW38_RS25540 (QKW38_25540) 16995..17771 + 777 WP_000015958.1 site-specific integrase -
QKW38_RS25545 (QKW38_25545) 17829..18086 - 258 WP_000764642.1 hypothetical protein -
QKW38_RS25550 (QKW38_25550) 18215..18319 - 105 WP_032409716.1 hypothetical protein -
QKW38_RS25555 (QKW38_25555) 18854..19720 + 867 WP_004118283.1 replication initiation protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul1 / armA / msr(E) / mph(E) / fosA3 / blaCTX-M-14 / mcr-1.1 / sul2 / aph(4)-Ia / aac(3)-IVa / qnrB4 / blaDHA-1 - 1..315303 315303


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T281382 WP_001044770.1 NZ_CP124874:c15065-14649 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT281382 WP_001261282.1 NZ_CP124874:c15292-15062 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References