Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5143060..5143685 | Replicon | chromosome |
Accession | NZ_CP124873 | ||
Organism | Klebsiella pneumoniae strain K82 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A378FVD4 |
Locus tag | QKW38_RS25075 | Protein ID | WP_019705794.1 |
Coordinates | 5143060..5143443 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | QKW38_RS25080 | Protein ID | WP_004150355.1 |
Coordinates | 5143443..5143685 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QKW38_RS25060 (5140426) | 5140426..5141328 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
QKW38_RS25065 (5141325) | 5141325..5141960 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
QKW38_RS25070 (5141957) | 5141957..5142886 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
QKW38_RS25075 (5143060) | 5143060..5143443 | - | 384 | WP_019705794.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QKW38_RS25080 (5143443) | 5143443..5143685 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
QKW38_RS25085 (5143890) | 5143890..5144807 | + | 918 | WP_004146235.1 | alpha/beta hydrolase | - |
QKW38_RS25090 (5144822) | 5144822..5145763 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
QKW38_RS25095 (5145808) | 5145808..5146245 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
QKW38_RS25100 (5146242) | 5146242..5147102 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
QKW38_RS25105 (5147096) | 5147096..5147695 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14358.57 Da Isoelectric Point: 6.8806
>T281381 WP_019705794.1 NZ_CP124873:c5143443-5143060 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A378FVD4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |