Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4645444..4645960 | Replicon | chromosome |
Accession | NZ_CP124873 | ||
Organism | Klebsiella pneumoniae strain K82 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | QKW38_RS22715 | Protein ID | WP_004178374.1 |
Coordinates | 4645444..4645728 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | QKW38_RS22720 | Protein ID | WP_002886901.1 |
Coordinates | 4645718..4645960 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QKW38_RS22690 (4640839) | 4640839..4641102 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
QKW38_RS22695 (4641232) | 4641232..4641405 | + | 174 | WP_032412860.1 | hypothetical protein | - |
QKW38_RS22700 (4641408) | 4641408..4642151 | + | 744 | WP_282851341.1 | MurR/RpiR family transcriptional regulator | - |
QKW38_RS22705 (4642508) | 4642508..4644646 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QKW38_RS22710 (4644976) | 4644976..4645440 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QKW38_RS22715 (4645444) | 4645444..4645728 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QKW38_RS22720 (4645718) | 4645718..4645960 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QKW38_RS22725 (4646038) | 4646038..4647948 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
QKW38_RS22730 (4647971) | 4647971..4649125 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
QKW38_RS22735 (4649192) | 4649192..4649932 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T281379 WP_004178374.1 NZ_CP124873:c4645728-4645444 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |