Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3904084..3904703 | Replicon | chromosome |
Accession | NZ_CP124873 | ||
Organism | Klebsiella pneumoniae strain K82 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | QKW38_RS19210 | Protein ID | WP_002892050.1 |
Coordinates | 3904485..3904703 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | QKW38_RS19205 | Protein ID | WP_002892066.1 |
Coordinates | 3904084..3904458 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QKW38_RS19195 (3899236) | 3899236..3900429 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QKW38_RS19200 (3900452) | 3900452..3903598 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
QKW38_RS19205 (3904084) | 3904084..3904458 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
QKW38_RS19210 (3904485) | 3904485..3904703 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
QKW38_RS19215 (3904866) | 3904866..3905432 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
QKW38_RS19220 (3905404) | 3905404..3905544 | - | 141 | WP_004147370.1 | hypothetical protein | - |
QKW38_RS19225 (3905565) | 3905565..3906035 | + | 471 | WP_002892026.1 | YlaC family protein | - |
QKW38_RS19230 (3906010) | 3906010..3907461 | - | 1452 | WP_064151794.1 | PLP-dependent aminotransferase family protein | - |
QKW38_RS19235 (3907562) | 3907562..3908260 | + | 699 | WP_002892021.1 | GNAT family protein | - |
QKW38_RS19240 (3908257) | 3908257..3908397 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
QKW38_RS19245 (3908397) | 3908397..3908660 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T281377 WP_002892050.1 NZ_CP124873:3904485-3904703 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT281377 WP_002892066.1 NZ_CP124873:3904084-3904458 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |