Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 682627..683306 | Replicon | chromosome |
| Accession | NZ_CP124873 | ||
| Organism | Klebsiella pneumoniae strain K82 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A0C7K7A4 |
| Locus tag | QKW38_RS03350 | Protein ID | WP_020324801.1 |
| Coordinates | 682965..683306 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A0C7KEL2 |
| Locus tag | QKW38_RS03345 | Protein ID | WP_020324792.1 |
| Coordinates | 682627..682944 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QKW38_RS03320 (677841) | 677841..680993 | + | 3153 | WP_022631414.1 | AIDA repeat-containing protein | - |
| QKW38_RS03325 (681086) | 681086..681325 | + | 240 | WP_020324820.1 | DUF905 domain-containing protein | - |
| QKW38_RS03330 (681428) | 681428..681886 | + | 459 | WP_020324813.1 | antirestriction protein | - |
| QKW38_RS03335 (681902) | 681902..682378 | + | 477 | WP_020324797.1 | RadC family protein | - |
| QKW38_RS03340 (682387) | 682387..682614 | + | 228 | WP_020324796.1 | DUF987 domain-containing protein | - |
| QKW38_RS03345 (682627) | 682627..682944 | + | 318 | WP_020324792.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QKW38_RS03350 (682965) | 682965..683306 | + | 342 | WP_020324801.1 | TA system toxin CbtA family protein | Toxin |
| QKW38_RS03355 (683422) | 683422..684255 | + | 834 | WP_020324805.1 | DUF4942 domain-containing protein | - |
| QKW38_RS03365 (684558) | 684558..685064 | + | 507 | WP_002917636.1 | G/U mismatch-specific DNA glycosylase | - |
| QKW38_RS03370 (685164) | 685164..687005 | - | 1842 | WP_004174339.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 651170..684255 | 33085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12818.91 Da Isoelectric Point: 9.1484
>T281370 WP_020324801.1 NZ_CP124873:682965-683306 [Klebsiella pneumoniae]
MKTLPAIISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFCDETVIQEHIDAGITLADAVNFLVEKYGLVRIDRNGF
VWQEQSPYLRAVDILRARQATGLLRQSRNNAIR
MKTLPAIISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFCDETVIQEHIDAGITLADAVNFLVEKYGLVRIDRNGF
VWQEQSPYLRAVDILRARQATGLLRQSRNNAIR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0C7K7A4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0C7KEL2 |