Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4573648..4574164 | Replicon | chromosome |
Accession | NZ_CP124866 | ||
Organism | Klebsiella quasipneumoniae strain M7 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QJS48_RS22185 | Protein ID | WP_064187962.1 |
Coordinates | 4573648..4573932 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A1C1EW86 |
Locus tag | QJS48_RS22190 | Protein ID | WP_023291757.1 |
Coordinates | 4573922..4574164 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJS48_RS22170 (4568690) | 4568690..4570345 | + | 1656 | WP_064178460.1 | alpha,alpha-phosphotrehalase | - |
QJS48_RS22175 (4570731) | 4570731..4572869 | + | 2139 | WP_004206513.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QJS48_RS22180 (4573180) | 4573180..4573644 | + | 465 | WP_061155975.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QJS48_RS22185 (4573648) | 4573648..4573932 | - | 285 | WP_064187962.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QJS48_RS22190 (4573922) | 4573922..4574164 | - | 243 | WP_023291757.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QJS48_RS22195 (4574242) | 4574242..4576152 | - | 1911 | WP_200541779.1 | PRD domain-containing protein | - |
QJS48_RS22200 (4576175) | 4576175..4577326 | - | 1152 | WP_023319593.1 | lactonase family protein | - |
QJS48_RS22205 (4577393) | 4577393..4578133 | - | 741 | WP_080841787.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11141.01 Da Isoelectric Point: 10.6094
>T281363 WP_064187962.1 NZ_CP124866:c4573932-4573648 [Klebsiella quasipneumoniae]
MTYELAFDPRAWREWQKLGETIKKQFKNKLQQVVQNPRTESARLSDLPDCYKIKLKASGYRLVYQVRDRVVVVYVIAIGK
REKAAVYHQANKRL
MTYELAFDPRAWREWQKLGETIKKQFKNKLQQVVQNPRTESARLSDLPDCYKIKLKASGYRLVYQVRDRVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|