Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3874980..3875599 Replicon chromosome
Accession NZ_CP124866
Organism Klebsiella quasipneumoniae strain M7

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QJS48_RS18855 Protein ID WP_002892050.1
Coordinates 3875381..3875599 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QJS48_RS18850 Protein ID WP_002892066.1
Coordinates 3874980..3875354 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJS48_RS18840 (3870134) 3870134..3871327 + 1194 WP_004204747.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QJS48_RS18845 (3871350) 3871350..3874496 + 3147 WP_004204748.1 multidrug efflux RND transporter permease subunit AcrB -
QJS48_RS18850 (3874980) 3874980..3875354 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QJS48_RS18855 (3875381) 3875381..3875599 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QJS48_RS18860 (3875758) 3875758..3876324 + 567 WP_282861722.1 maltose O-acetyltransferase -
QJS48_RS18865 (3876296) 3876296..3876418 - 123 WP_032426076.1 hypothetical protein -
QJS48_RS18870 (3876461) 3876461..3876931 + 471 WP_004204751.1 YlaC family protein -
QJS48_RS18875 (3876900) 3876900..3878357 - 1458 WP_136023152.1 PLP-dependent aminotransferase family protein -
QJS48_RS18880 (3878458) 3878458..3879153 + 696 Protein_3702 GNAT family protein -
QJS48_RS18885 (3879153) 3879153..3879293 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QJS48_RS18890 (3879293) 3879293..3879556 - 264 WP_004204754.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T281362 WP_002892050.1 NZ_CP124866:3875381-3875599 [Klebsiella quasipneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT281362 WP_002892066.1 NZ_CP124866:3874980-3875354 [Klebsiella quasipneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References