Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 804522..805179 | Replicon | chromosome |
Accession | NZ_CP124866 | ||
Organism | Klebsiella quasipneumoniae strain M7 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A2A5MNX1 |
Locus tag | QJS48_RS04010 | Protein ID | WP_004205323.1 |
Coordinates | 804769..805179 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | QJS48_RS04005 | Protein ID | WP_002916312.1 |
Coordinates | 804522..804788 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJS48_RS03980 (799725) | 799725..801158 | - | 1434 | WP_004205314.1 | 6-phospho-beta-glucosidase BglA | - |
QJS48_RS03985 (801277) | 801277..802005 | - | 729 | WP_004205316.1 | MurR/RpiR family transcriptional regulator | - |
QJS48_RS03990 (802055) | 802055..802366 | + | 312 | WP_004205318.1 | N(4)-acetylcytidine aminohydrolase | - |
QJS48_RS03995 (802529) | 802529..803188 | + | 660 | WP_004205319.1 | hemolysin III family protein | - |
QJS48_RS04000 (803293) | 803293..804276 | - | 984 | WP_049116109.1 | tRNA-modifying protein YgfZ | - |
QJS48_RS04005 (804522) | 804522..804788 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
QJS48_RS04010 (804769) | 804769..805179 | + | 411 | WP_004205323.1 | protein YgfX | Toxin |
QJS48_RS04015 (805186) | 805186..805707 | - | 522 | WP_004205324.1 | flavodoxin FldB | - |
QJS48_RS04020 (805808) | 805808..806704 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
QJS48_RS04025 (806727) | 806727..807440 | + | 714 | WP_004205326.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QJS48_RS04030 (807446) | 807446..809179 | + | 1734 | WP_017899799.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16035.83 Da Isoelectric Point: 11.4778
>T281355 WP_004205323.1 NZ_CP124866:804769-805179 [Klebsiella quasipneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
DWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
DWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A5MNX1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |