Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 4305376..4306003 | Replicon | chromosome |
| Accession | NZ_CP124862 | ||
| Organism | Petroclostridium sp. X23 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | QKW49_RS20185 | Protein ID | WP_282864438.1 |
| Coordinates | 4305653..4306003 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | QKW49_RS20180 | Protein ID | WP_282864437.1 |
| Coordinates | 4305376..4305651 (+) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QKW49_RS20155 (QKW49_20155) | 4300848..4301222 | + | 375 | WP_282868196.1 | holo-ACP synthase | - |
| QKW49_RS20160 (QKW49_20160) | 4301233..4302783 | + | 1551 | WP_282868197.1 | NAD(P)H-hydrate dehydratase | - |
| QKW49_RS20165 (QKW49_20165) | 4302805..4303251 | + | 447 | WP_282864434.1 | CBS domain-containing protein | - |
| QKW49_RS20170 (QKW49_20170) | 4303344..4303970 | + | 627 | WP_282864435.1 | hypothetical protein | - |
| QKW49_RS20175 (QKW49_20175) | 4303985..4305151 | + | 1167 | WP_282864436.1 | alanine racemase | - |
| QKW49_RS20180 (QKW49_20180) | 4305376..4305651 | + | 276 | WP_282864437.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| QKW49_RS20185 (QKW49_20185) | 4305653..4306003 | + | 351 | WP_282864438.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QKW49_RS20190 (QKW49_20190) | 4306068..4306586 | + | 519 | WP_282864439.1 | hypothetical protein | - |
| QKW49_RS20195 (QKW49_20195) | 4306726..4307574 | - | 849 | WP_282864440.1 | MurR/RpiR family transcriptional regulator | - |
| QKW49_RS20200 (QKW49_20200) | 4307764..4309041 | - | 1278 | WP_282864441.1 | enolase C-terminal domain-like protein | - |
| QKW49_RS20205 (QKW49_20205) | 4309138..4310556 | - | 1419 | WP_282864442.1 | DUF4147 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12801.81 Da Isoelectric Point: 5.8816
>T281353 WP_282864438.1 NZ_CP124862:4305653-4306003 [Petroclostridium sp. X23]
VVVKRGDIYYADLSPVIGSEQGGIRPVLIVQNDVGNRYSPTVIAAAITSQINKAKLPTHIEINAQEFGLSKDSVILLEQI
RTIDKKRLKEKIGRLDDELMEKVNDALSISFGLVEL
VVVKRGDIYYADLSPVIGSEQGGIRPVLIVQNDVGNRYSPTVIAAAITSQINKAKLPTHIEINAQEFGLSKDSVILLEQI
RTIDKKRLKEKIGRLDDELMEKVNDALSISFGLVEL
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|