Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-pasA/RelE-HTH
Location 5502..5973 Replicon plasmid unnamed3
Accession NZ_CP124844
Organism Aeromonas salmonicida strain 57

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag QLQ87_RS23610 Protein ID WP_083221093.1
Coordinates 5502..5765 (-) Length 88 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID A0A428V512
Locus tag QLQ87_RS23615 Protein ID WP_068979446.1
Coordinates 5749..5973 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ87_RS23565 (QLQ87_23565) 581..781 - 201 WP_282684750.1 hypothetical protein -
QLQ87_RS23570 (QLQ87_23570) 789..1076 - 288 WP_282684751.1 hypothetical protein -
QLQ87_RS23575 (QLQ87_23575) 1176..1484 - 309 WP_282684752.1 mobilization protein -
QLQ87_RS23580 (QLQ87_23580) 1485..2021 - 537 WP_282684753.1 DUF1640 domain-containing protein -
QLQ87_RS23585 (QLQ87_23585) 2062..2628 - 567 Protein_6 relaxase/mobilization nuclease domain-containing protein -
QLQ87_RS23590 (QLQ87_23590) 2720..3133 - 414 WP_282684754.1 plasmid mobilization relaxosome protein MobC -
QLQ87_RS23595 (QLQ87_23595) 3341..3631 + 291 WP_282684755.1 hypothetical protein -
QLQ87_RS23600 (QLQ87_23600) 3784..4749 - 966 WP_282684756.1 replication initiation protein -
QLQ87_RS23605 (QLQ87_23605) 4925..5473 - 549 WP_282684749.1 hypothetical protein -
QLQ87_RS23610 (QLQ87_23610) 5502..5765 - 264 WP_083221093.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QLQ87_RS23615 (QLQ87_23615) 5749..5973 - 225 WP_068979446.1 DUF6290 family protein Antitoxin
QLQ87_RS23620 (QLQ87_23620) 6103..6303 - 201 WP_282684750.1 hypothetical protein -
QLQ87_RS23625 (QLQ87_23625) 6311..6598 - 288 WP_282684751.1 hypothetical protein -
QLQ87_RS23630 (QLQ87_23630) 6697..7005 - 309 WP_282684752.1 mobilization protein -
QLQ87_RS23635 (QLQ87_23635) 7006..7542 - 537 WP_282684753.1 DUF1640 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..7725 7725


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin

Relaxosome protein TraY

(4-47)


Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 10302.99 Da        Isoelectric Point: 9.9924

>T281350 WP_083221093.1 NZ_CP124844:c5765-5502 [Aeromonas salmonicida]
MAWKVELTDTAKKQLARLDKTQAQRITKYLRRVMLLEDPRDAGKALTGNLRTYWRYRVGDYRVVCEIRDNEMIIVAVMVG
HRSDIYE

Download         Length: 264 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8704.85 Da        Isoelectric Point: 4.3640

>AT281350 WP_068979446.1 NZ_CP124844:c5973-5749 [Aeromonas salmonicida]
MLAIRLPSDIEERLANLAQETGRTKTFYAREAILTHLEEMEDYYLAERVMEKVRKGEERLFSLDDVERDLGLES

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A428V512

References