Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 32475..33057 | Replicon | plasmid pK6328_2 |
| Accession | NZ_CP124839 | ||
| Organism | Klebsiella pneumoniae strain KPN6328 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | E8PSG2 |
| Locus tag | QHR28_RS28000 | Protein ID | WP_013583078.1 |
| Coordinates | 32475..32771 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A223LLE5 |
| Locus tag | QHR28_RS28005 | Protein ID | WP_058998984.1 |
| Coordinates | 32773..33057 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QHR28_RS27955 (QHR28_27955) | 28985..29206 | - | 222 | WP_058998969.1 | hypothetical protein | - |
| QHR28_RS27960 (QHR28_27960) | 29319..29840 | + | 522 | WP_058998971.1 | J domain-containing protein | - |
| QHR28_RS27965 (QHR28_27965) | 29882..30097 | + | 216 | WP_058998973.1 | hypothetical protein | - |
| QHR28_RS27970 (QHR28_27970) | 30109..30315 | + | 207 | WP_058998975.1 | hypothetical protein | - |
| QHR28_RS27975 (QHR28_27975) | 30315..30857 | + | 543 | WP_058998977.1 | hypothetical protein | - |
| QHR28_RS27980 (QHR28_27980) | 30854..31111 | + | 258 | WP_058998978.1 | hypothetical protein | - |
| QHR28_RS27985 (QHR28_27985) | 31101..31334 | + | 234 | WP_072223385.1 | hypothetical protein | - |
| QHR28_RS27990 (QHR28_27990) | 31740..31952 | + | 213 | WP_058998981.1 | hypothetical protein | - |
| QHR28_RS27995 (QHR28_27995) | 31999..32136 | + | 138 | WP_161400388.1 | hypothetical protein | - |
| QHR28_RS28000 (QHR28_28000) | 32475..32771 | + | 297 | WP_013583078.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QHR28_RS28005 (QHR28_28005) | 32773..33057 | + | 285 | WP_058998984.1 | putative addiction module antidote protein | Antitoxin |
| QHR28_RS28010 (QHR28_28010) | 33403..33948 | + | 546 | WP_058998986.1 | hypothetical protein | - |
| QHR28_RS28015 (QHR28_28015) | 33952..35121 | + | 1170 | WP_058998988.1 | MobP1 family relaxase | - |
| QHR28_RS28020 (QHR28_28020) | 35118..35525 | - | 408 | WP_072223386.1 | helix-turn-helix transcriptional regulator | - |
| QHR28_RS28025 (QHR28_28025) | 35917..36411 | + | 495 | WP_058998990.1 | transcription termination/antitermination NusG family protein | - |
| QHR28_RS28030 (QHR28_28030) | 36401..36598 | + | 198 | WP_058998992.1 | hypothetical protein | - |
| QHR28_RS28035 (QHR28_28035) | 36605..37234 | + | 630 | WP_058998994.1 | lytic transglycosylase domain-containing protein | - |
| QHR28_RS28040 (QHR28_28040) | 37252..37545 | + | 294 | WP_058998996.1 | TrbC/VirB2 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaKPC-33 | - | 1..45465 | 45465 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11290.10 Da Isoelectric Point: 10.3166
>T281346 WP_013583078.1 NZ_CP124839:32475-32771 [Klebsiella pneumoniae]
MIEIKRTPEVEKWLRSLKDRTAKAKILMRLERMEDGNFGDVEPIGDGLSELRIHQGKGYRVYFGNKNNQIILLLCGGDKS
TQQADIRKAKQLAKQWGF
MIEIKRTPEVEKWLRSLKDRTAKAKILMRLERMEDGNFGDVEPIGDGLSELRIHQGKGYRVYFGNKNNQIILLLCGGDKS
TQQADIRKAKQLAKQWGF
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A223LLP6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A223LLE5 |