Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/upstrm_HI1419-dnstrm_HI1420
Location 32475..33057 Replicon plasmid pK6328_2
Accession NZ_CP124839
Organism Klebsiella pneumoniae strain KPN6328

Toxin (Protein)


Gene name PumA Uniprot ID E8PSG2
Locus tag QHR28_RS28000 Protein ID WP_013583078.1
Coordinates 32475..32771 (+) Length 99 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A223LLE5
Locus tag QHR28_RS28005 Protein ID WP_058998984.1
Coordinates 32773..33057 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QHR28_RS27955 (QHR28_27955) 28985..29206 - 222 WP_058998969.1 hypothetical protein -
QHR28_RS27960 (QHR28_27960) 29319..29840 + 522 WP_058998971.1 J domain-containing protein -
QHR28_RS27965 (QHR28_27965) 29882..30097 + 216 WP_058998973.1 hypothetical protein -
QHR28_RS27970 (QHR28_27970) 30109..30315 + 207 WP_058998975.1 hypothetical protein -
QHR28_RS27975 (QHR28_27975) 30315..30857 + 543 WP_058998977.1 hypothetical protein -
QHR28_RS27980 (QHR28_27980) 30854..31111 + 258 WP_058998978.1 hypothetical protein -
QHR28_RS27985 (QHR28_27985) 31101..31334 + 234 WP_072223385.1 hypothetical protein -
QHR28_RS27990 (QHR28_27990) 31740..31952 + 213 WP_058998981.1 hypothetical protein -
QHR28_RS27995 (QHR28_27995) 31999..32136 + 138 WP_161400388.1 hypothetical protein -
QHR28_RS28000 (QHR28_28000) 32475..32771 + 297 WP_013583078.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QHR28_RS28005 (QHR28_28005) 32773..33057 + 285 WP_058998984.1 putative addiction module antidote protein Antitoxin
QHR28_RS28010 (QHR28_28010) 33403..33948 + 546 WP_058998986.1 hypothetical protein -
QHR28_RS28015 (QHR28_28015) 33952..35121 + 1170 WP_058998988.1 MobP1 family relaxase -
QHR28_RS28020 (QHR28_28020) 35118..35525 - 408 WP_072223386.1 helix-turn-helix transcriptional regulator -
QHR28_RS28025 (QHR28_28025) 35917..36411 + 495 WP_058998990.1 transcription termination/antitermination NusG family protein -
QHR28_RS28030 (QHR28_28030) 36401..36598 + 198 WP_058998992.1 hypothetical protein -
QHR28_RS28035 (QHR28_28035) 36605..37234 + 630 WP_058998994.1 lytic transglycosylase domain-containing protein -
QHR28_RS28040 (QHR28_28040) 37252..37545 + 294 WP_058998996.1 TrbC/VirB2 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaKPC-33 - 1..45465 45465


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-92)

Antitoxin

Cro/C1-type helix-turn-helix domain

(46-89)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11290.10 Da        Isoelectric Point: 10.3166

>T281346 WP_013583078.1 NZ_CP124839:32475-32771 [Klebsiella pneumoniae]
MIEIKRTPEVEKWLRSLKDRTAKAKILMRLERMEDGNFGDVEPIGDGLSELRIHQGKGYRVYFGNKNNQIILLLCGGDKS
TQQADIRKAKQLAKQWGF

Download         Length: 297 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10557.97 Da        Isoelectric Point: 4.7254

>AT281346 WP_058998984.1 NZ_CP124839:32773-33057 [Klebsiella pneumoniae]
MKEELKKFDVVEFLEDEEDIQEYLNAAIEEDDTKYLFKALGNIARARNISQLSKEVGMSREGIYKALSGEGNPSFQTVSK
ITKALGLKLHFTGA

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A223LLP6

Antitoxin

Source ID Structure
AlphaFold DB A0A223LLE5

References