Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 55891..56534 | Replicon | plasmid pK6328_1 |
| Accession | NZ_CP124838 | ||
| Organism | Klebsiella pneumoniae strain KPN6328 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | QHR28_RS27335 | Protein ID | WP_001044770.1 |
| Coordinates | 55891..56307 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | QHR28_RS27340 | Protein ID | WP_001261282.1 |
| Coordinates | 56304..56534 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QHR28_RS27315 (51994) | 51994..52266 | - | 273 | Protein_61 | transposase | - |
| QHR28_RS27325 (53248) | 53248..54270 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
| QHR28_RS27330 (54255) | 54255..55817 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
| QHR28_RS27335 (55891) | 55891..56307 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QHR28_RS27340 (56304) | 56304..56534 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QHR28_RS27345 (56491) | 56491..56952 | + | 462 | WP_014343465.1 | hypothetical protein | - |
| QHR28_RS27350 (57113) | 57113..58057 | + | 945 | WP_011977810.1 | hypothetical protein | - |
| QHR28_RS27355 (58094) | 58094..58486 | + | 393 | WP_011977811.1 | hypothetical protein | - |
| QHR28_RS27360 (58544) | 58544..59065 | + | 522 | WP_013214008.1 | hypothetical protein | - |
| QHR28_RS27365 (59111) | 59111..59314 | + | 204 | WP_011977813.1 | hypothetical protein | - |
| QHR28_RS27370 (59344) | 59344..60348 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
| QHR28_RS27375 (60532) | 60532..61311 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaKPC-33 / blaTEM-1B / rmtB | - | 1..119030 | 119030 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T281344 WP_001044770.1 NZ_CP124838:c56307-55891 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |