Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 559085..559721 | Replicon | chromosome |
Accession | NZ_CP124831 | ||
Organism | Bacillus altitudinis strain Sample7_7 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | K2MHT4 |
Locus tag | QJS65_RS02725 | Protein ID | WP_003214169.1 |
Coordinates | 559371..559721 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | W8QJ31 |
Locus tag | QJS65_RS02720 | Protein ID | WP_003214273.1 |
Coordinates | 559085..559366 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJS65_RS02700 (QJS65_02700) | 555239..555844 | - | 606 | WP_007496491.1 | rhomboid family intramembrane serine protease | - |
QJS65_RS02705 (QJS65_02705) | 555939..556304 | + | 366 | WP_282746647.1 | holo-ACP synthase | - |
QJS65_RS02710 (QJS65_02710) | 556465..557481 | + | 1017 | WP_282746648.1 | DUF4367 domain-containing protein | - |
QJS65_RS02715 (QJS65_02715) | 557610..558791 | + | 1182 | WP_017358396.1 | alanine racemase | - |
QJS65_RS02720 (QJS65_02720) | 559085..559366 | + | 282 | WP_003214273.1 | hypothetical protein | Antitoxin |
QJS65_RS02725 (QJS65_02725) | 559371..559721 | + | 351 | WP_003214169.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QJS65_RS02730 (QJS65_02730) | 559836..560666 | + | 831 | WP_017358395.1 | RsbT co-antagonist protein RsbRA | - |
QJS65_RS02735 (QJS65_02735) | 560671..561039 | + | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
QJS65_RS02740 (QJS65_02740) | 561042..561443 | + | 402 | WP_003214085.1 | anti-sigma regulatory factor | - |
QJS65_RS02745 (QJS65_02745) | 561454..562461 | + | 1008 | WP_017358394.1 | PP2C family protein-serine/threonine phosphatase | - |
QJS65_RS02750 (QJS65_02750) | 562521..562850 | + | 330 | WP_017358393.1 | anti-sigma factor antagonist | - |
QJS65_RS02755 (QJS65_02755) | 562847..563335 | + | 489 | WP_017358392.1 | anti-sigma B factor RsbW | - |
QJS65_RS02760 (QJS65_02760) | 563301..564089 | + | 789 | WP_012009000.1 | RNA polymerase sigma factor SigB | - |
QJS65_RS02765 (QJS65_02765) | 564089..564688 | + | 600 | WP_024719202.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12976.99 Da Isoelectric Point: 5.1663
>T281327 WP_003214169.1 NZ_CP124831:559371-559721 [Bacillus altitudinis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | K2MHT4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A081L854 |