Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3895475..3896094 Replicon chromosome
Accession NZ_CP124827
Organism Klebsiella pneumoniae strain K147

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QLG19_RS19365 Protein ID WP_002892050.1
Coordinates 3895876..3896094 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QLG19_RS19360 Protein ID WP_002892066.1
Coordinates 3895475..3895849 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLG19_RS19350 (QLG19_19350) 3890627..3891820 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QLG19_RS19355 (QLG19_19355) 3891843..3894989 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
QLG19_RS19360 (QLG19_19360) 3895475..3895849 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QLG19_RS19365 (QLG19_19365) 3895876..3896094 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QLG19_RS19370 (QLG19_19370) 3896253..3896819 + 567 WP_002892030.1 maltose O-acetyltransferase -
QLG19_RS19375 (QLG19_19375) 3896791..3896931 - 141 WP_004147370.1 hypothetical protein -
QLG19_RS19380 (QLG19_19380) 3896952..3897422 + 471 WP_002892026.1 YlaC family protein -
QLG19_RS19385 (QLG19_19385) 3897397..3898848 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
QLG19_RS19390 (QLG19_19390) 3898949..3899647 + 699 WP_002892021.1 GNAT family protein -
QLG19_RS19395 (QLG19_19395) 3899644..3899784 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QLG19_RS19400 (QLG19_19400) 3899784..3900047 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T281321 WP_002892050.1 NZ_CP124827:3895876-3896094 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT281321 WP_002892066.1 NZ_CP124827:3895475-3895849 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References