Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 872229..872886 | Replicon | chromosome |
Accession | NZ_CP124827 | ||
Organism | Klebsiella pneumoniae strain K147 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | QLG19_RS04405 | Protein ID | WP_002916310.1 |
Coordinates | 872476..872886 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | QLG19_RS04400 | Protein ID | WP_002916312.1 |
Coordinates | 872229..872495 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLG19_RS04375 (QLG19_04375) | 867385..868818 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
QLG19_RS04380 (QLG19_04380) | 868937..869665 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
QLG19_RS04385 (QLG19_04385) | 869715..870026 | + | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
QLG19_RS04390 (QLG19_04390) | 870190..870849 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
QLG19_RS04395 (QLG19_04395) | 871000..871983 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
QLG19_RS04400 (QLG19_04400) | 872229..872495 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
QLG19_RS04405 (QLG19_04405) | 872476..872886 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
QLG19_RS04410 (QLG19_04410) | 872893..873414 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
QLG19_RS04415 (QLG19_04415) | 873515..874411 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
QLG19_RS04420 (QLG19_04420) | 874434..875147 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QLG19_RS04425 (QLG19_04425) | 875153..876886 | + | 1734 | WP_004151783.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T281315 WP_002916310.1 NZ_CP124827:872476-872886 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |