Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 68184..68920 | Replicon | plasmid unnamed |
Accession | NZ_CP124825 | ||
Organism | Klebsiella pneumoniae strain H53 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A8T5ZF70 |
Locus tag | QLG18_RS26420 | Protein ID | WP_004187044.1 |
Coordinates | 68184..68666 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | QLG18_RS26425 | Protein ID | WP_003026799.1 |
Coordinates | 68654..68920 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLG18_RS26400 (QLG18_26400) | 63494..64288 | - | 795 | WP_004187050.1 | tetratricopeptide repeat protein | - |
QLG18_RS26405 (QLG18_26405) | 64347..65693 | - | 1347 | WP_077250283.1 | ISNCY family transposase | - |
QLG18_RS26410 (QLG18_26410) | 65920..66552 | + | 633 | WP_004883463.1 | hypothetical protein | - |
QLG18_RS26415 (QLG18_26415) | 66581..67984 | - | 1404 | WP_004883460.1 | ISNCY-like element ISKpn21 family transposase | - |
QLG18_RS26420 (QLG18_26420) | 68184..68666 | - | 483 | WP_004187044.1 | GNAT family N-acetyltransferase | Toxin |
QLG18_RS26425 (QLG18_26425) | 68654..68920 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
QLG18_RS26430 (QLG18_26430) | 69071..69775 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
QLG18_RS26435 (QLG18_26435) | 69934..72519 | - | 2586 | WP_004187040.1 | EAL domain-containing protein | - |
QLG18_RS26440 (QLG18_26440) | 72488..72733 | - | 246 | WP_032238678.1 | hypothetical protein | - |
QLG18_RS26445 (QLG18_26445) | 72791..73771 | - | 981 | Protein_68 | IS5-like element ISKpn26 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..160770 | 160770 | |
- | inside | IScluster/Tn | - | - | 64347..73771 | 9424 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17280.93 Da Isoelectric Point: 8.7197
>T281310 WP_004187044.1 NZ_CP124825:c68666-68184 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|