Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4758723..4759239 | Replicon | chromosome |
Accession | NZ_CP124824 | ||
Organism | Klebsiella pneumoniae strain H53 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | QLG18_RS23440 | Protein ID | WP_004178374.1 |
Coordinates | 4758723..4759007 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | QLG18_RS23445 | Protein ID | WP_002886901.1 |
Coordinates | 4758997..4759239 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLG18_RS23415 (4754118) | 4754118..4754381 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
QLG18_RS23420 (4754511) | 4754511..4754684 | + | 174 | WP_264865108.1 | hypothetical protein | - |
QLG18_RS23425 (4754687) | 4754687..4755430 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
QLG18_RS23430 (4755787) | 4755787..4757925 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QLG18_RS23435 (4758255) | 4758255..4758719 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QLG18_RS23440 (4758723) | 4758723..4759007 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QLG18_RS23445 (4758997) | 4758997..4759239 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QLG18_RS23450 (4759317) | 4759317..4761227 | - | 1911 | WP_264865109.1 | BglG family transcription antiterminator | - |
QLG18_RS23455 (4761250) | 4761250..4762404 | - | 1155 | WP_023159544.1 | lactonase family protein | - |
QLG18_RS23460 (4762471) | 4762471..4763211 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T281307 WP_004178374.1 NZ_CP124824:c4759007-4758723 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |