Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 4674891..4675594 | Replicon | chromosome |
Accession | NZ_CP124824 | ||
Organism | Klebsiella pneumoniae strain H53 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | QLG18_RS23070 | Protein ID | WP_282676469.1 |
Coordinates | 4674891..4675232 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | QLG18_RS23075 | Protein ID | WP_282676470.1 |
Coordinates | 4675253..4675594 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLG18_RS23055 (4670385) | 4670385..4671872 | + | 1488 | WP_095885150.1 | HEPN domain-containing protein | - |
QLG18_RS23065 (4673634) | 4673634..4674641 | - | 1008 | WP_282676468.1 | restriction endonuclease | - |
QLG18_RS23070 (4674891) | 4674891..4675232 | - | 342 | WP_282676469.1 | TA system toxin CbtA family protein | Toxin |
QLG18_RS23075 (4675253) | 4675253..4675594 | - | 342 | WP_282676470.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QLG18_RS23080 (4675605) | 4675605..4676147 | - | 543 | WP_282676471.1 | DNA repair protein RadC | - |
QLG18_RS23085 (4676160) | 4676160..4676600 | - | 441 | WP_282676472.1 | antirestriction protein | - |
QLG18_RS23090 (4676605) | 4676605..4677453 | - | 849 | WP_282676473.1 | DUF932 domain-containing protein | - |
QLG18_RS23095 (4677573) | 4677573..4678046 | - | 474 | WP_282676474.1 | hypothetical protein | - |
QLG18_RS23100 (4678118) | 4678118..4678570 | - | 453 | WP_000734321.1 | hypothetical protein | - |
QLG18_RS23105 (4678606) | 4678606..4679322 | - | 717 | WP_282676475.1 | WYL domain-containing protein | - |
QLG18_RS23110 (4679566) | 4679566..4680441 | - | 876 | WP_282676476.1 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4663278..4700398 | 37120 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12704.66 Da Isoelectric Point: 7.1648
>T281306 WP_282676469.1 NZ_CP124824:c4675232-4674891 [Klebsiella pneumoniae]
MKTLPATSPQAATLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGIILADAVNFLVEKYELVRIDRRGF
NWQEQSPYLGAVDILRARQATGLLKRNRISAAR
MKTLPATSPQAATLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGIILADAVNFLVEKYELVRIDRRGF
NWQEQSPYLGAVDILRARQATGLLKRNRISAAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|