Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4634255..4635065 | Replicon | chromosome |
Accession | NZ_CP124824 | ||
Organism | Klebsiella pneumoniae strain H53 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A060VJ83 |
Locus tag | QLG18_RS22860 | Protein ID | WP_004178461.1 |
Coordinates | 4634255..4634788 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | QLG18_RS22865 | Protein ID | WP_002887278.1 |
Coordinates | 4634799..4635065 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLG18_RS22855 (4633086) | 4633086..4634207 | + | 1122 | WP_016946712.1 | cupin domain-containing protein | - |
QLG18_RS22860 (4634255) | 4634255..4634788 | - | 534 | WP_004178461.1 | type II toxin-antitoxin system toxin KacT | Toxin |
QLG18_RS22865 (4634799) | 4634799..4635065 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
QLG18_RS22870 (4635168) | 4635168..4636601 | - | 1434 | WP_048255468.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
QLG18_RS22875 (4636591) | 4636591..4637274 | - | 684 | WP_032105399.1 | copper response regulator transcription factor CusR | - |
QLG18_RS22880 (4637446) | 4637446..4638831 | + | 1386 | WP_264865422.1 | efflux transporter outer membrane subunit | - |
QLG18_RS22885 (4638849) | 4638849..4639181 | + | 333 | WP_264865424.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19810.65 Da Isoelectric Point: 5.2614
>T281305 WP_004178461.1 NZ_CP124824:c4634788-4634255 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VJ83 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLZ1 |