Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4170301..4171088 Replicon chromosome
Accession NZ_CP124824
Organism Klebsiella pneumoniae strain H53

Toxin (Protein)


Gene name yeeV Uniprot ID A0A377E3D6
Locus tag QLG18_RS20640 Protein ID WP_001194695.1
Coordinates 4170301..4170678 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2H9G3E7
Locus tag QLG18_RS20645 Protein ID WP_000066236.1
Coordinates 4170729..4171088 (-) Length 120 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLG18_RS20610 (4165998) 4165998..4167101 + 1104 WP_225208280.1 glutamate 5-kinase -
QLG18_RS20615 (4167112) 4167112..4168365 + 1254 WP_004147253.1 glutamate-5-semialdehyde dehydrogenase -
QLG18_RS20625 (4168656) 4168656..4169501 - 846 Protein_4048 DUF4942 domain-containing protein -
QLG18_RS20630 (4169583) 4169583..4169786 - 204 WP_023568001.1 DUF957 domain-containing protein -
QLG18_RS20635 (4169813) 4169813..4170304 - 492 WP_032416105.1 DUF5983 family protein -
QLG18_RS20640 (4170301) 4170301..4170678 - 378 WP_001194695.1 TA system toxin CbtA family protein Toxin
QLG18_RS20645 (4170729) 4170729..4171088 - 360 WP_000066236.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QLG18_RS20650 (4171112) 4171112..4171333 - 222 WP_000691981.1 DUF987 domain-containing protein -
QLG18_RS20655 (4171354) 4171354..4171833 - 480 WP_000437750.1 DNA repair protein RadC -
QLG18_RS20660 (4171845) 4171845..4172315 - 471 WP_032416102.1 antirestriction protein -
QLG18_RS20665 (4172583) 4172583..4173401 - 819 WP_032416100.1 DUF932 domain-containing protein -
QLG18_RS20670 (4173521) 4173521..4173754 - 234 WP_001114682.1 DUF905 domain-containing protein -
QLG18_RS20675 (4173831) 4173831..4174283 - 453 WP_020837115.1 IrmA family protein -
QLG18_RS20680 (4174343) 4174343..4174885 - 543 WP_001104018.1 DUF4339 domain-containing protein -
QLG18_RS20685 (4174948) 4174948..4175400 - 453 WP_000734138.1 hypothetical protein -
QLG18_RS20690 (4175397) 4175397..4175849 - 453 WP_001020418.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(15-114)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14180.97 Da        Isoelectric Point: 7.4209

>T281304 WP_001194695.1 NZ_CP124824:c4170678-4170301 [Klebsiella pneumoniae]
MQTQPLSSTQEATSRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRIDRHGF
STETQLPRLTSIDILRARKATGLMTRNDYRTVTDITTGKYRGGHR

Download         Length: 378 bp

Antitoxin


Download         Length: 120 a.a.        Molecular weight: 13127.02 Da        Isoelectric Point: 7.0261

>AT281304 WP_000066236.1 NZ_CP124824:c4171088-4170729 [Klebsiella pneumoniae]
MSNKIPTVNHDITEPWWGLKRSITPCFGARLVQSGNCLHYLADRASITGQFSDGDLRHLDQAFPLLLKQLELMLTSGELT
PRHQHCVTLYAKGLTCEADSLGSHGYVYLAIYPTPAATA

Download         Length: 360 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A377E3D6

Antitoxin

Source ID Structure
AlphaFold DB A0A2H9G3E7

References