Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4000956..4001575 Replicon chromosome
Accession NZ_CP124824
Organism Klebsiella pneumoniae strain H53

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QLG18_RS19770 Protein ID WP_002892050.1
Coordinates 4001357..4001575 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QLG18_RS19765 Protein ID WP_002892066.1
Coordinates 4000956..4001330 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLG18_RS19755 (3996108) 3996108..3997301 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QLG18_RS19760 (3997324) 3997324..4000470 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
QLG18_RS19765 (4000956) 4000956..4001330 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QLG18_RS19770 (4001357) 4001357..4001575 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QLG18_RS19775 (4001734) 4001734..4002300 + 567 WP_002892030.1 maltose O-acetyltransferase -
QLG18_RS19780 (4002272) 4002272..4002412 - 141 WP_004147370.1 hypothetical protein -
QLG18_RS19785 (4002433) 4002433..4002903 + 471 WP_002892026.1 YlaC family protein -
QLG18_RS19790 (4002878) 4002878..4004329 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
QLG18_RS19795 (4004430) 4004430..4005128 + 699 WP_002892021.1 GNAT family protein -
QLG18_RS19800 (4005125) 4005125..4005265 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QLG18_RS19805 (4005265) 4005265..4005528 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T281303 WP_002892050.1 NZ_CP124824:4001357-4001575 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT281303 WP_002892066.1 NZ_CP124824:4000956-4001330 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References