281293

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 8373..8874 Replicon plasmid unnamed3
Accession NZ_CP124823
Organism Escherichia coli strain C325

Toxin (Protein)


Gene name TsxA Uniprot ID A0A6X6XTU7
Locus tag QLG17_RS27875 Protein ID WP_000702245.1
Coordinates 8373..8633 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID -
Locus tag QLG17_RS27880 Protein ID WP_001132407.1
Coordinates 8623..8874 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLG17_RS27830 (QLG17_27830) 3911..4063 + 153 Protein_3 DUF5431 family protein -
QLG17_RS27835 (QLG17_27835) 4008..4130 + 123 WP_274538960.1 Hok/Gef family protein -
QLG17_RS27840 (QLG17_27840) 4280..4876 + 597 WP_000125164.1 ProQ/FINO family protein -
QLG17_RS27845 (QLG17_27845) 4894..5178 - 285 WP_001162371.1 hypothetical protein -
QLG17_RS27850 (QLG17_27850) 5252..5917 - 666 WP_000532148.1 division plane positioning ATPase MipZ -
QLG17_RS27855 (QLG17_27855) 6515..6844 + 330 WP_282633290.1 hypothetical protein -
QLG17_RS27860 (QLG17_27860) 7426..7749 + 324 WP_000432876.1 hypothetical protein -
QLG17_RS27865 (QLG17_27865) 7790..7999 + 210 WP_000866037.1 hypothetical protein -
QLG17_RS27870 (QLG17_27870) 8097..8321 + 225 WP_000814384.1 hypothetical protein -
QLG17_RS27875 (QLG17_27875) 8373..8633 + 261 WP_000702245.1 hypothetical protein Toxin
QLG17_RS27880 (QLG17_27880) 8623..8874 + 252 WP_001132407.1 transcriptional regulator Antitoxin
QLG17_RS27885 (QLG17_27885) 9424..9702 + 279 WP_097297109.1 cobalamin biosynthesis protein CbiX -
QLG17_RS27890 (QLG17_27890) 10090..10533 - 444 WP_000192626.1 hypothetical protein -
QLG17_RS27895 (QLG17_27895) 10830..11012 + 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
QLG17_RS27900 (QLG17_27900) 11037..11474 + 438 WP_000466318.1 type II toxin-antitoxin system HicB family antitoxin -
QLG17_RS27905 (QLG17_27905) 11605..11931 - 327 WP_000206697.1 hypothetical protein -
QLG17_RS27910 (QLG17_27910) 11928..12137 - 210 WP_000951714.1 hypothetical protein -
QLG17_RS27915 (QLG17_27915) 12139..12336 - 198 WP_282633303.1 hypothetical protein -
QLG17_RS27920 (QLG17_27920) 12338..12532 - 195 WP_000224733.1 hypothetical protein -
QLG17_RS27925 (QLG17_27925) 12864..12986 - 123 Protein_22 hypothetical protein -
QLG17_RS27930 (QLG17_27930) 13006..13605 - 600 WP_000091423.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..59433 59433
- flank IS/Tn - - 2302..3450 1148


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-37)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9818.23 Da        Isoelectric Point: 9.5163

>T281293 WP_000702245.1 NZ_CP124823:8373-8633 [Escherichia coli]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEEAFDTIDFASDGLRENDKEIVSMMIQEMS
EGKNAK

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9404.77 Da        Isoelectric Point: 9.8120

>AT281293 WP_001132407.1 NZ_CP124823:8623-8874 [Escherichia coli]
MPNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6X6XTU7

Antitoxin

Source ID Structure

References