Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 42543..43078 Replicon plasmid unnamed1
Accession NZ_CP124820
Organism Escherichia coli strain C325

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag QLG17_RS26620 Protein ID WP_001270421.1
Coordinates 42543..42830 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A1V0M724
Locus tag QLG17_RS26625 Protein ID WP_001132893.1
Coordinates 42827..43078 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLG17_RS26590 (38144) 38144..38965 - 822 WP_001302199.1 polysaccharide deacetylase family protein -
QLG17_RS26595 (39232) 39232..39474 - 243 WP_001014903.1 hypothetical protein -
QLG17_RS26600 (40440) 40440..40592 + 153 Protein_50 IS3 family transposase -
QLG17_RS26605 (40781) 40781..41968 - 1188 WP_052915449.1 IS91 family transposase -
QLG17_RS26610 (41968) 41968..42333 - 366 WP_000091308.1 hypothetical protein -
QLG17_RS26615 (42419) 42419..42541 - 123 Protein_53 IS3 family transposase -
QLG17_RS26620 (42543) 42543..42830 - 288 WP_001270421.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QLG17_RS26625 (42827) 42827..43078 - 252 WP_001132893.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QLG17_RS26630 (43252) 43252..43569 - 318 WP_157910106.1 hypothetical protein -
QLG17_RS26635 (43796) 43796..45001 + 1206 WP_000817642.1 AAA family ATPase -
QLG17_RS26640 (44998) 44998..45960 + 963 WP_000756329.1 ParB family protein -
QLG17_RS26645 (46100) 46100..46468 - 369 Protein_59 DUF4113 domain-containing protein -
QLG17_RS26650 (46656) 46656..47843 - 1188 WP_052915449.1 IS91 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - hlyC / hlyA / hlyB / hlyD / stcE / exeE / exeG 1..87527 87527
- inside IScluster/Tn - - 40440..48816 8376


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11244.27 Da        Isoelectric Point: 10.4703

>T281291 WP_001270421.1 NZ_CP124820:c42830-42543 [Escherichia coli]
MRYQVKFREDALKEWQKLDKTIQQQFAKKLKKCCDNPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDEQLIIAVVAVGK
RERSDVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9192.50 Da        Isoelectric Point: 4.2108

>AT281291 WP_001132893.1 NZ_CP124820:c43078-42827 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGFPIAILNRNQPAFYCVPAELYEKMLDALDDQELVKLVAERSNQPLHDVDLD
KYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A1V0M724

References