Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4421337..4421991 | Replicon | chromosome |
Accession | NZ_CP124819 | ||
Organism | Escherichia coli strain C325 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | QLG17_RS22075 | Protein ID | WP_000244777.1 |
Coordinates | 4421584..4421991 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QLG17_RS22070 | Protein ID | WP_000354046.1 |
Coordinates | 4421337..4421603 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLG17_RS22050 (4417425) | 4417425..4418858 | - | 1434 | WP_024221758.1 | 6-phospho-beta-glucosidase BglA | - |
QLG17_RS22055 (4418903) | 4418903..4419214 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
QLG17_RS22060 (4419378) | 4419378..4420037 | + | 660 | WP_000250294.1 | hemolysin III family protein | - |
QLG17_RS22065 (4420114) | 4420114..4421094 | - | 981 | WP_000886093.1 | tRNA-modifying protein YgfZ | - |
QLG17_RS22070 (4421337) | 4421337..4421603 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QLG17_RS22075 (4421584) | 4421584..4421991 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
QLG17_RS22080 (4422031) | 4422031..4422552 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QLG17_RS22085 (4422664) | 4422664..4423560 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QLG17_RS22090 (4423585) | 4423585..4424295 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QLG17_RS22095 (4424301) | 4424301..4426034 | + | 1734 | WP_000813202.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T281286 WP_000244777.1 NZ_CP124819:4421584-4421991 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |