Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 3864264..3865064 | Replicon | chromosome |
| Accession | NZ_CP124819 | ||
| Organism | Escherichia coli strain C325 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | U9Y257 |
| Locus tag | QLG17_RS19225 | Protein ID | WP_000342447.1 |
| Coordinates | 3864537..3865064 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | U9Y285 |
| Locus tag | QLG17_RS19220 | Protein ID | WP_001277109.1 |
| Coordinates | 3864264..3864530 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLG17_RS19200 (3859922) | 3859922..3860590 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
| QLG17_RS19205 (3860583) | 3860583..3861641 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
| QLG17_RS19210 (3861886) | 3861886..3862740 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| QLG17_RS19215 (3863011) | 3863011..3864114 | + | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| QLG17_RS19220 (3864264) | 3864264..3864530 | + | 267 | WP_001277109.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| QLG17_RS19225 (3864537) | 3864537..3865064 | + | 528 | WP_000342447.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| QLG17_RS19230 (3865061) | 3865061..3865444 | - | 384 | WP_000778795.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| QLG17_RS19235 (3865868) | 3865868..3866977 | + | 1110 | WP_052915153.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| QLG17_RS19240 (3867025) | 3867025..3867951 | + | 927 | WP_000003013.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| QLG17_RS19245 (3867948) | 3867948..3869225 | + | 1278 | WP_000803782.1 | branched chain amino acid ABC transporter permease LivM | - |
| QLG17_RS19250 (3869222) | 3869222..3869989 | + | 768 | WP_000082096.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19673.63 Da Isoelectric Point: 7.0284
>T281282 WP_000342447.1 NZ_CP124819:3864537-3865064 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDHSIQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDHSIQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LUM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LUN0 |