Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2993030..2993828 | Replicon | chromosome |
| Accession | NZ_CP124819 | ||
| Organism | Escherichia coli strain C325 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0F3UPG9 |
| Locus tag | QLG17_RS15070 | Protein ID | WP_000854698.1 |
| Coordinates | 2993451..2993828 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0F3T7G0 |
| Locus tag | QLG17_RS15065 | Protein ID | WP_000017094.1 |
| Coordinates | 2993030..2993404 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLG17_RS15030 (2989676) | 2989676..2990131 | + | 456 | WP_000581506.1 | IrmA family protein | - |
| QLG17_RS15035 (2990232) | 2990232..2990440 | + | 209 | Protein_2945 | DUF905 family protein | - |
| QLG17_RS15040 (2990541) | 2990541..2991362 | + | 822 | WP_001761104.1 | DUF932 domain-containing protein | - |
| QLG17_RS15045 (2991362) | 2991362..2991562 | + | 201 | WP_001420888.1 | hypothetical protein | - |
| QLG17_RS15050 (2991700) | 2991700..2992173 | + | 474 | WP_000855084.1 | antirestriction protein | - |
| QLG17_RS15055 (2992189) | 2992189..2992665 | + | 477 | WP_025380661.1 | RadC family protein | - |
| QLG17_RS15060 (2992734) | 2992734..2992955 | + | 222 | WP_001220316.1 | DUF987 domain-containing protein | - |
| QLG17_RS15065 (2993030) | 2993030..2993404 | + | 375 | WP_000017094.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QLG17_RS15070 (2993451) | 2993451..2993828 | + | 378 | WP_000854698.1 | TA system toxin CbtA family protein | Toxin |
| QLG17_RS15075 (2993825) | 2993825..2994313 | + | 489 | WP_001054226.1 | DUF5983 family protein | - |
| QLG17_RS15080 (2994325) | 2994325..2994522 | + | 198 | WP_000839251.1 | DUF957 domain-containing protein | - |
| QLG17_RS15085 (2994607) | 2994607..2995449 | + | 843 | WP_001280439.1 | DUF4942 domain-containing protein | - |
| QLG17_RS15090 (2996198) | 2996198..2997736 | + | 1539 | WP_001187177.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13975.94 Da Isoelectric Point: 7.9087
>T281278 WP_000854698.1 NZ_CP124819:2993451-2993828 [Escherichia coli]
MKTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRSHYRTVNDITLGKRTEAKR
MKTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRSHYRTVNDITLGKRTEAKR
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13732.42 Da Isoelectric Point: 5.4488
>AT281278 WP_000017094.1 NZ_CP124819:2993030-2993404 [Escherichia coli]
VSGTLHETNYPNDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSGTLHETNYPNDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0F3UPG9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0F3T7G0 |