Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 2860513..2861108 | Replicon | chromosome |
| Accession | NZ_CP124819 | ||
| Organism | Escherichia coli strain C325 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | U9Y4M4 |
| Locus tag | QLG17_RS14390 | Protein ID | WP_000239579.1 |
| Coordinates | 2860513..2860863 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | - |
| Locus tag | QLG17_RS14395 | Protein ID | WP_052915232.1 |
| Coordinates | 2860857..2861108 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLG17_RS14370 (2855959) | 2855959..2856981 | - | 1023 | WP_001400707.1 | ABC transporter permease | - |
| QLG17_RS14375 (2856995) | 2856995..2858497 | - | 1503 | WP_052915233.1 | sugar ABC transporter ATP-binding protein | - |
| QLG17_RS14380 (2858637) | 2858637..2859593 | - | 957 | WP_000265940.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| QLG17_RS14385 (2859903) | 2859903..2860433 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| QLG17_RS14390 (2860513) | 2860513..2860863 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
| QLG17_RS14395 (2860857) | 2860857..2861108 | - | 252 | WP_052915232.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| QLG17_RS14400 (2861320) | 2861320..2861661 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| QLG17_RS14405 (2861664) | 2861664..2865443 | - | 3780 | WP_033810330.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T281277 WP_000239579.1 NZ_CP124819:c2860863-2860513 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|