Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 2565327..2565877 Replicon chromosome
Accession NZ_CP124819
Organism Escherichia coli strain C325

Toxin (Protein)


Gene name ccdB Uniprot ID Q32K46
Locus tag QLG17_RS13025 Protein ID WP_001160974.1
Coordinates 2565327..2565641 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QLG17_RS13030 Protein ID WP_000125566.1
Coordinates 2565644..2565877 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLG17_RS13000 (2561002) 2561002..2562288 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QLG17_RS13005 (2562288) 2562288..2563277 + 990 WP_000241240.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QLG17_RS13010 (2563274) 2563274..2564095 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QLG17_RS13015 (2564098) 2564098..2564475 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QLG17_RS13020 (2564482) 2564482..2565330 + 849 WP_000257195.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QLG17_RS13025 (2565327) 2565327..2565641 - 315 WP_001160974.1 CcdB family protein Toxin
QLG17_RS13030 (2565644) 2565644..2565877 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QLG17_RS13035 (2565963) 2565963..2566442 - 480 WP_024221573.1 type 3 dihydrofolate reductase -
QLG17_RS13040 (2566633) 2566633..2568495 - 1863 WP_000377117.1 glutathione-regulated potassium-efflux system protein KefC -
QLG17_RS13045 (2568488) 2568488..2569018 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QLG17_RS13050 (2569129) 2569129..2570460 - 1332 WP_001183192.1 MFS transporter -
QLG17_RS13055 (2570518) 2570518..2570805 - 288 WP_000203748.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11737.84 Da        Isoelectric Point: 9.8517

>T281276 WP_001160974.1 NZ_CP124819:c2565641-2565327 [Escherichia coli]
MQFTVYRSRSRNAAFPFVIDVTSDIIGVINRRIVIPLTPIERFIRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT281276 WP_000125566.1 NZ_CP124819:c2565877-2565644 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LRR3

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References