Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 1489708..1490189 Replicon chromosome
Accession NZ_CP124819
Organism Escherichia coli strain C325

Toxin (Protein)


Gene name parE_1 Uniprot ID -
Locus tag QLG17_RS07900 Protein ID WP_021568727.1
Coordinates 1489899..1490189 (+) Length 97 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID -
Locus tag QLG17_RS07895 Protein ID WP_000108762.1
Coordinates 1489708..1489899 (+) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLG17_RS07860 (1485268) 1485268..1485681 - 414 WP_001151233.1 DUF977 family protein -
QLG17_RS07865 (1485697) 1485697..1486467 - 771 WP_000451007.1 DUF1627 domain-containing protein -
QLG17_RS07870 (1486489) 1486489..1487235 - 747 WP_000788742.1 ATP-binding protein -
QLG17_RS07875 (1487242) 1487242..1488324 - 1083 WP_032313415.1 phage replisome organizer -
QLG17_RS07880 (1488396) 1488396..1488821 - 426 WP_025380293.1 toxin YdaT family protein -
QLG17_RS07885 (1488818) 1488818..1489082 - 265 Protein_1553 helix-turn-helix transcriptional regulator -
QLG17_RS07890 (1489190) 1489190..1489690 + 501 WP_025380292.1 helix-turn-helix transcriptional regulator -
QLG17_RS07895 (1489708) 1489708..1489899 + 192 WP_000108762.1 hypothetical protein Antitoxin
QLG17_RS07900 (1489899) 1489899..1490189 + 291 WP_021568727.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QLG17_RS07905 (1490463) 1490463..1490615 + 153 WP_000367377.1 DUF1391 family protein -
QLG17_RS07910 (1490714) 1490714..1491160 - 447 WP_025380291.1 hypothetical protein -
QLG17_RS07915 (1491864) 1491864..1492052 + 189 WP_000413705.1 cell division inhibition protein DicB -
QLG17_RS07920 (1492049) 1492049..1492240 + 192 WP_001098307.1 DUF1482 family protein -
QLG17_RS07925 (1492334) 1492334..1494769 + 2436 WP_025380290.1 exonuclease -
QLG17_RS07930 (1494837) 1494837..1495079 + 243 WP_000273151.1 DUF4224 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - nleH2 / nleB2 1446073..1500791 54718
- inside Prophage - nleF / nleH2 / nleB2 1432094..1500791 68697


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11105.96 Da        Isoelectric Point: 9.9854

>T281274 WP_021568727.1 NZ_CP124819:1489899-1490189 [Escherichia coli]
MLPILWLPSARDDLRQIVAYIAKENPPAARRLKIRIETSVLSLSEHPYLYPPSERALGLREIVTHPNYIILYRVTASNIE
IVNVVHSRRQYPNKSC

Download         Length: 291 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7075.91 Da        Isoelectric Point: 4.0270

>AT281274 WP_000108762.1 NZ_CP124819:1489708-1489899 [Escherichia coli]
MSTVLSPIISEFETIEQENSYNEWLRTKVAASLADPRPAIPHDEVMAEMENLIAQIASTNRSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References