Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 384714..385509 Replicon chromosome
Accession NZ_CP124819
Organism Escherichia coli strain C325

Toxin (Protein)


Gene name yeeV Uniprot ID B7UP43
Locus tag QLG17_RS02075 Protein ID WP_000854914.1
Coordinates 385135..385509 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A7U9LM11
Locus tag QLG17_RS02070 Protein ID WP_001280953.1
Coordinates 384714..385088 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLG17_RS02040 (380069) 380069..380974 + 906 WP_000203541.1 diguanylate cyclase regulator RdcB family protein -
QLG17_RS02045 (380971) 380971..382041 + 1071 WP_000102669.1 patatin-like phospholipase family protein -
QLG17_RS02050 (382381) 382381..383199 + 819 WP_001234682.1 DUF932 domain-containing protein -
QLG17_RS02055 (383290) 383290..383775 + 486 WP_000214398.1 antirestriction protein -
QLG17_RS02060 (383791) 383791..384267 + 477 WP_001186738.1 RadC family protein -
QLG17_RS02065 (384330) 384330..384551 + 222 WP_000692323.1 DUF987 domain-containing protein -
QLG17_RS02070 (384714) 384714..385088 + 375 WP_001280953.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QLG17_RS02075 (385135) 385135..385509 + 375 WP_000854914.1 TA system toxin CbtA family protein Toxin
QLG17_RS02080 (385506) 385506..385997 + 492 WP_000976857.1 DUF5983 family protein -
QLG17_RS02085 (386009) 386009..386206 + 198 WP_000839282.1 DUF957 domain-containing protein -
QLG17_RS02090 (386291) 386291..387133 + 843 WP_001280481.1 DUF4942 domain-containing protein -
QLG17_RS02100 (387604) 387604..388543 + 940 Protein_410 glyoxylate/hydroxypyruvate reductase GhrA -
QLG17_RS02105 (388598) 388598..389335 + 738 WP_000283664.1 zinc-binding phosphatase -
QLG17_RS02110 (389359) 389359..389913 + 555 WP_001001917.1 molecular chaperone YcdY -
QLG17_RS02115 (390015) 390015..390506 + 492 WP_001297187.1 DUF1097 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - csgG / csgF / csgE / csgD / csgB / csgA / csgC 372973..395444 22471


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14117.17 Da        Isoelectric Point: 7.7761

>T281269 WP_000854914.1 NZ_CP124819:385135-385509 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13734.56 Da        Isoelectric Point: 6.6249

>AT281269 WP_001280953.1 NZ_CP124819:384714-385088 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLNAKGLTCEADTLGSCGYVYLAVYPTPALATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LXR5

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LM11

References